• Featured Product
  • KD/KO Validated

GADD34 Polyclonal antibody

GADD34 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10449-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (4)

Applications

WB, IHC, IF/ICC, IP, ELISA

PPP1R15A, growth arrest and DNA damage-inducible protein 34, Growth arrest and DNA damage-inducible protein GADD34

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMG132 treated NIH/3T3 cells, Tunicamycin treated HeLa cells, PC-3 cells, K-562 cells, HepG2 cells, Jurkat cells
Positive IP detected inK-562 cells, NIH/3T3 cells
Positive IHC detected inhuman pancreas tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMG132 treated U2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10449-1-AP targets GADD34 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, monkey, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0578

Product name: Recombinant human GADD34 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 307-572 aa of BC003067

Sequence: SDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAG

Predict reactive species
Full Name protein phosphatase 1, regulatory (inhibitor) subunit 15A
Calculated Molecular Weight 73 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC003067
Gene Symbol GADD34
Gene ID (NCBI) 23645
RRIDAB_2168724
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75807
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GADD34, also named PPP1R15A, belongs to the PPP1R15 family. GADD34 can be triggered as a direct target of activating transcription factor4 (ATF4) under ER stress, it plays a pivotal role in the recovery of cells from shut-down of translation induced by ER stress. It recruits the serine/threonine-protein phosphatase (PP1) to dephosphorylate the translation initiation factor eIF2alpha, thereby reversing the shut-off of protein synthesis initiated by stress-inducible kinases and facilitating recovery of cells from stress. GADD34 down-regulates the TGF-beta signaling pathway by promoting dephosphorylation of TGFB1 via PP1. It may also promote apoptosis by inducing TP53 phosphorylation on 'Ser-15'. Starvation-induced expression of GADD34 reduced mTOR activity and induced autophagy in wild-type mice, but not in GADD34 KO mice. Molecular weight of GADD34 is 100 kDa confirmed in GADD34 KO mice, and Proteintech's GADD34 antibody 10449-1-AP primarily recongize the 100 kDa band.

Protocols

Product Specific Protocols
IF protocol for GADD34 antibody 10449-1-APDownload protocol
IHC protocol for GADD34 antibody 10449-1-APDownload protocol
IP protocol for GADD34 antibody 10449-1-APDownload protocol
WB protocol for GADD34 antibody 10449-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Nature

Stress response silencing by an E3 ligase mutated in neurodegeneration

Authors - Diane L Haakonsen

Nature

Ageing promotes metastasis via activation of the integrated stress response

Authors - Angana A H Patel
humanWB

Nature

An inhibitor of NEDD8-activating enzyme as a new approach to treat cancer.

Authors - Soucy Teresa A TA
mouseWB,IHC

Nature

Sustained translational repression by eIF2α-P mediates prion neurodegeneration.

Authors - Moreno Julie A JA
humanWB

Science

Preventing proteostasis diseases by selective inhibition of a phosphatase regulatory subunit.

Authors - Indrajit Das
humanWB

Cell

Target-Based Discovery of an Inhibitor of the Regulatory Phosphatase PPP1R15B.

Authors - Agnieszka Krzyzosiak

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Ana (Verified Customer) (03-11-2021)

GADD34 in mouse muscle. 10 ug of protein. BSA blocking. 1:1000 primary ab dilution O/N incubation 4ºC.1:5000 secondary ab HRP conjugated.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse Muscle
GADD34 Antibody Western Blot validation (1:1000 dilution) in Mouse Muscle (Cat no:10449-1-AP)
FH

Maria (Verified Customer) (02-10-2021)

GADD34 in human primary fibroblasts. UT and TN treated. PFA 4% 20 min. Blocking: PBST (0.1% Triton) 10% Goat Serum 1h RT. Primary incubation: 16h 4ºC 1:200 in PBST 10% GS. Secondary: 2h RT 1:500 Goat anti-rabbit Alexa fluor 555 in PBST 10% GS.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Human primary fibroblasts
GADD34 Antibody Immunofluorescence validation (1:200 dilution) in Human primary fibroblasts (Cat no:10449-1-AP)
FH

Daniel (Verified Customer) (10-01-2019)

Cytoplasmic staining of the tubules of wild-type kidneys.

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse kidney
GADD34 Antibody Immunohistochemistry, validation (1:100 dilution) in Mouse kidney (Cat no:10449-1-AP)
FH

Stefan (Verified Customer) (07-31-2019)

See publication:Dalton LE, Clarke HJ, Knight J, Lawson MH, Wason J, Lomas DA, Howat WJ, Rintoul RC, Rassl DM, Marciniak SJ. (2013). The endoplasmic reticulum stress marker CHOP predicts survival in malignant mesothelioma. Br J Cancer. 2013 Apr 2;108(6):1340-7. doi: 10.1038/bjc.2013.66. Epub 2013 Feb 14.https://www.nature.com/articles/bjc201366

  • Applications: Western Blot, Immunohistochemistry,
  • Primary Antibody Dilution: WB 1:1000, IHC 1:100
  • Cell Tissue Type: HCT116 human colon carcinoma
GADD34 Antibody Western Blot,Immunohistochemistry, validation (WB 1:1000, IHC 1:100 dilution) in HCT116 human colon carcinoma (Cat no:10449-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...