PP4R4 Polyclonal antibody

• 

  WB analysis using 20124-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20124-1-AP (PP4R4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

PP4R4 Polyclonal Antibody for WB, ELISA

Cat No. 20124-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PPP4R4, KIAA1622, Serine/threonine-protein phosphatase 4 regulatory subunit 4

---

Tested Applications

• Positive WB detected in: rat brain tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20124-1-AP targets PP4R4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13868

  Product name: Recombinant human PPP4R4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC002650

  Sequence: MHPPPPAAAMDFSQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR

• Full Name: protein phosphatase 4, regulatory subunit 4
• Calculated Molecular Weight: 417 aa, 47 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC002650
• Gene Symbol: PP4R4
• Gene ID (NCBI): 57718
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6NUP7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PP4R4 (also known as SMEK1) is a regulatory subunit of protein phosphatase 4 (PP4), a serine/threonine phosphatase complex crucial for diverse cellular processes. It plays a key role in directing PP4's activity and substrate specificity, particularly in the DNA damage response, cell cycle progression, and centrosome maturation. Studies highlight its involvement in critical pathways such as ATM/ATR signaling for DNA repair and its regulatory function in cell division. Dysregulation of PP4R4 is implicated in genomic instability and is associated with various diseases, including cancer.