Tested Applications
| Positive WB detected in | rat brain tissue, rat testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20124-1-AP targets PP4R4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13868 Product name: Recombinant human PPP4R4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC002650 Sequence: MHPPPPAAAMDFSQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR Predict reactive species |
| Full Name | protein phosphatase 4, regulatory subunit 4 |
| Calculated Molecular Weight | 417 aa, 47 kDa |
| Observed Molecular Weight | 90-100 kDa |
| GenBank Accession Number | BC002650 |
| Gene Symbol | PP4R4 |
| Gene ID (NCBI) | 57718 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6NUP7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PP4R4 (also known as SMEK1) is a regulatory subunit of protein phosphatase 4 (PP4), a serine/threonine phosphatase complex crucial for diverse cellular processes. It plays a key role in directing PP4's activity and substrate specificity, particularly in the DNA damage response, cell cycle progression, and centrosome maturation. Studies highlight its involvement in critical pathways such as ATM/ATR signaling for DNA repair and its regulatory function in cell division. Dysregulation of PP4R4 is implicated in genomic instability and is associated with various diseases, including cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PP4R4 antibody 20124-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

