PPYR1 Polyclonal antibody

PPYR1 Polyclonal Antibody for IHC, ELISA
Cat No. 21654-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Neuropeptide Y receptor type 4, PP1, PPYR1, Y4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21654-1-AP targets PPYR1 in IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16374

Product name: Recombinant human PPYR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 317-375 aa of BC096238

Sequence: VNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSLRLSGRSNPI

Predict reactive species
Full Name pancreatic polypeptide receptor 1
Calculated Molecular Weight 375 aa, 42 kDa
GenBank Accession NumberBC096238
Gene Symbol PPYR1
Gene ID (NCBI) 5540
RRIDAB_2878900
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP50391
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPYR1 (pancreatic polypeptide receptor 1), also known as NPY4R, is a member of the G-protein coupled receptor 1 family. PPYR1 is a receptor for the PP-fold peptides (pancreatic polypeptide, peptide YY, and neuropeptide Y) and pancreatic polypeptide is the preferred ligand (PMID: 12626767). It may be regulating central nervous system, cardiovascular and gastrointestinal function. It has been reported that PPYR1 gene is a key regulator of energy homeostasis (PMID: 12000791). PPYR1 gene copy number gain has been associated with lower body mass index (BMI) (PMID: 19229253).

Protocols

Product Specific Protocols
IHC protocol for PPYR1 antibody 21654-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...