Tested Applications
Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21654-1-AP targets PPYR1 in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16374 Product name: Recombinant human PPYR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 317-375 aa of BC096238 Sequence: VNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSLRLSGRSNPI Predict reactive species |
Full Name | pancreatic polypeptide receptor 1 |
Calculated Molecular Weight | 375 aa, 42 kDa |
GenBank Accession Number | BC096238 |
Gene Symbol | PPYR1 |
Gene ID (NCBI) | 5540 |
RRID | AB_2878900 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P50391 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PPYR1 (pancreatic polypeptide receptor 1), also known as NPY4R, is a member of the G-protein coupled receptor 1 family. PPYR1 is a receptor for the PP-fold peptides (pancreatic polypeptide, peptide YY, and neuropeptide Y) and pancreatic polypeptide is the preferred ligand (PMID: 12626767). It may be regulating central nervous system, cardiovascular and gastrointestinal function. It has been reported that PPYR1 gene is a key regulator of energy homeostasis (PMID: 12000791). PPYR1 gene copy number gain has been associated with lower body mass index (BMI) (PMID: 19229253).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for PPYR1 antibody 21654-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |