PPYR1 Polyclonal antibody

• 

  IHC staining of human small intestine using 21654-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 21654-1-AP (PPYR1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human small intestine using 21654-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 21654-1-AP (PPYR1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human small intestine using 21654-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 21654-1-AP (PPYR1 Antibody) at dilution of 1:50 (under 40x lens).

PPYR1 Polyclonal Antibody for IHC, ELISA

Cat No. 21654-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

Neuropeptide Y receptor type 4, PP1, PPYR1, Y4

---

Tested Applications

• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21654-1-AP targets PPYR1 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16374

  Product name: Recombinant human PPYR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 317-375 aa of BC096238

  Sequence: VNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSLRLSGRSNPI

• Full Name: pancreatic polypeptide receptor 1
• Calculated Molecular Weight: 375 aa, 42 kDa
• GenBank Accession Number: BC096238
• Gene Symbol: PPYR1
• Gene ID (NCBI): 5540
• RRID: AB_2878900
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50391
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPYR1 (pancreatic polypeptide receptor 1), also known as NPY4R, is a member of the G-protein coupled receptor 1 family. PPYR1 is a receptor for the PP-fold peptides (pancreatic polypeptide, peptide YY, and neuropeptide Y) and pancreatic polypeptide is the preferred ligand (PMID: 12626767). It may be regulating central nervous system, cardiovascular and gastrointestinal function. It has been reported that PPYR1 gene is a key regulator of energy homeostasis (PMID: 12000791). PPYR1 gene copy number gain has been associated with lower body mass index (BMI) (PMID: 19229253).