Tested Applications
| Positive WB detected in | HEK-293 cells |
| Positive IP detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23827-1-AP targets PRDM10 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20605 Product name: Recombinant human PRDM10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 806-1156 aa of BC112934 Sequence: AGPGEPDPMLSTHTQLTGTIATPPVCCPHCSKQYSSKTKMVQHIRKKHPEFAQLSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVASATSPHQSQQSTVDVGQLHDPQPYPQHAIQVQHIQVSEPTASAPSSAQVSGQPLSPSAQQAQQGLSPSHIQGSSSTQGQALQQQQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVTTGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSLDPQTNSQQQTTQYIITTTTNGNGSSEVHITKP Predict reactive species |
| Full Name | PR domain containing 10 |
| Calculated Molecular Weight | 1156 aa, 131 kDa |
| Observed Molecular Weight | 120-150 kDa |
| GenBank Accession Number | BC112934 |
| Gene Symbol | PRDM10 |
| Gene ID (NCBI) | 56980 |
| RRID | AB_2879330 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQV6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRDM10 is a member of PRDM family, which contains a PR(PRDI-BF1 and RIZ homology) domain, and PRDM is also a subgroup of PR/SET transcription factor family for its PR domain is similar to the catalytic motif of the SET domain of histone methyltransferase(HMTase). Thus PRDM is suggested involve in the regulation of genome expression and chromatin remodeling. PRDM10 shares characteristics with the PR/SET faimly and clusters of zinc fingers DNA binding motifs. It's postualated PRDM10 has an essential role in regulating gene expression and tissue differentiation and a gene repressor. It may play a role in the pathogenesis of gangliosidosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for PRDM10 antibody 23827-1-AP | Download protocol |
| WB protocol for PRDM10 antibody 23827-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



