PRDM13 Polyclonal antibody, PBS Only

• 

  WB analysis using 30453-1-AP (same clone as 30453-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30453-1-AP (PRDM13 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30453-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat eye using 30453-1-AP (same clone as 30453-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat eye tissue slide using 30453-1-AP (PRDM13 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30453-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat eye using 30453-1-AP (same clone as 30453-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat eye tissue slide using 30453-1-AP (PRDM13 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30453-1-PBS in a different storage buffer formulation.

PRDM13 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30453-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

PR domain containing 13, PFM10, MU MB 20.220

---

Product Information

30453-1-PBS targets PRDM13 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31014

  Product name: Recombinant human PRDM13 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 518-707 aa of NM_021620

  Sequence: IDREIAMHNQQLSEMAAGKGRGRLDSGTLPPAVAAAGGTGGGGSGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERDL

• Full Name: PR domain containing 13
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: NM_021620
• Gene Symbol: PRDM13
• Gene ID (NCBI): 59336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4Q3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.