PRIM1 Monoclonal antibody

• 

PRIM1 Monoclonal Antibody for ELISA

Cat No. 60021-1-Ig

Clone No.5H2C8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

ELISA

Synonyms

---

Product Information

60021-1-Ig targets PRIM1 in ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1124

  Product name: Recombinant human PRIM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 121-420 aa of BC005266

  Sequence: CCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF

• Full Name: primase, DNA, polypeptide 1 (49kDa)
• Calculated Molecular Weight: 50 kDa
• GenBank Accession Number: BC005266
• Gene Symbol: PRIM1
• Gene ID (NCBI): 5557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49642
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.