PRKAB1 Fusion Protein

Catalog number: Ag25534

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

PRKAB1 fusion protein Ag25534 SDS-PAGE


Product Name:
human PRKAB1-GST fusion protein

Catalog No:
Ag25534

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN
(1-70 aa encoded by BC001056)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top