Tested Applications
| Positive WB detected in | HeLa cells, Neuro-2a cells, SH-SY5Y cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human testis tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 15 publications below |
| IP | See 1 publications below |
Product Information
27398-1-AP targets PRKACA in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26392 Product name: Recombinant human PRKACA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 162-351 aa of BC039846 Sequence: DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF Predict reactive species |
| Full Name | protein kinase, cAMP-dependent, catalytic, alpha |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 38-43 kDa |
| GenBank Accession Number | BC039846 |
| Gene Symbol | PRKACA |
| Gene ID (NCBI) | 5566 |
| RRID | AB_2880861 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17612 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRKACA (protein kinase cAMP-activated catalytic subunit alpha) is a gene that encodes the catalytic subunit alpha of protein kinase A (PKA), a critical enzyme in the cyclic adenosine monophosphate (cAMP) signaling pathway. Functioning as the primary effector of cAMP, this kinase regulates a vast array of cellular processes, including metabolism, gene expression, cell cycle progression, and synaptic plasticity. Under basal conditions, the catalytic subunit is held inactive by regulatory subunits; upon cAMP binding, it is released and phosphorylates a diverse range of substrate proteins on serine and threonine residues. Beyond its physiological roles, aberrant PRKACA activity, particularly gene fusions and copy number gains, is a well-established driver of specific human diseases, most notably fibrolamellar hepatocellular carcinoma (FLC), where a characteristic DNAJB1-PRKACA fusion acts as the oncogenic driver.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PRKACA antibody 27398-1-AP | Download protocol |
| IHC protocol for PRKACA antibody 27398-1-AP | Download protocol |
| IP protocol for PRKACA antibody 27398-1-AP | Download protocol |
| WB protocol for PRKACA antibody 27398-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Pharmacol Phosphoproteomic and proteomic profiling in post-infarction chronic heart failure | ||
Microbiol Spectr Avian Hepatitis E Virus ORF2 Protein Interacts with Rap1b to Induce Cytoskeleton Rearrangement That Facilitates Virus Internalization. | ||
Eur J Pharmacol Theaflavine inhibits hepatic stellate cell activation by modulating the PKA/LKB1/AMPK/GSK3β cascade and subsequently enhancing Nrf2 signaling | ||
Mediators Inflamm Vitronectin Destroyed Intestinal Epithelial Cell Differentiation through Activation of PDE4-Mediated Ferroptosis in Inflammatory Bowel Disease | ||
Cell Rep Protein modifications throughout the lung cancer proteome unravel the cancer-specific regulation of glycolysis.
| ||
EMBO J E3 ubiquitin ligase CHIP facilitates cAMP and cGMP signalling cross-talk by polyubiquitinating PDE9A |















