PRKAR2B Polyclonal antibody, PBS Only

• 

  WB analysis using 28351-1-AP (same clone as 28351-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28351-1-AP (PRKAR2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28351-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28351-1-AP (same clone as 28351-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28351-1-AP (PRKAR2B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28351-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 28351-1-AP (same clone as 28351-1-PBS)

  IP result of anti-PRKAR2B (IP:28351-1-AP, 4ug; Detection:28351-1-AP 1:1000) with mouse brain tissue lysate 1080 ug. This data was developed using the same antibody clone with 28351-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 28351-1-AP (same clone as 28351-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 28351-1-AP (PRKAR2B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28351-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 28351-1-AP (same clone as 28351-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28351-1-AP (PRKAR2B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28351-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Neuro-2a using 28351-1-AP (same clone as 28351-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Neuro-2a cells using PRKAR2B antibody (28351-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 28351-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Neuro-2a using 28351-1-AP (same clone as 28351-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Neuro-2a cells using PRKAR2B antibody (28351-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 28351-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 28351-1-AP (same clone as 28351-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using PRKAR2B antibody (28351-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 28351-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 28351-1-AP (same clone as 28351-1-PBS)

  1X10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug Anti-Human PRKAR2B (28351-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 28351-1-PBS in a different storage buffer formulation.

PRKAR2B Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 28351-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

RII BETA, PRKAR2, cAMP-dependent protein kinase type II-beta regulatory subunit

---

Product Information

28351-1-PBS targets PRKAR2B in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28787

  Product name: Recombinant human PRKAR2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC075800

  Sequence: MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFCHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNP

• Full Name: protein kinase, cAMP-dependent, regulatory, type II, beta
• Calculated Molecular Weight: 418 aa, 46 kDa
• Observed Molecular Weight: 46-50 kDa
• GenBank Accession Number: BC075800
• Gene Symbol: PRKAR2B
• Gene ID (NCBI): 5577
• RRID: AB_2918156
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31323
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.