Tested Applications
| Positive WB detected in | Y79 cells, human testis tissue, mouse brain tissue, mouse eye tissue, rat brain tissue, mouse testis tissue | 
| Positive IP detected in | mouse brain tissue | 
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | Neuro-2a cells, SH-SY5Y cells | 
| Positive FC (Intra) detected in | SH-SY5Y cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
28351-1-AP targets PRKAR2B in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag28787 Product name: Recombinant human PRKAR2B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC075800 Sequence: MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFCHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNP Predict reactive species | 
                                    
| Full Name | protein kinase, cAMP-dependent, regulatory, type II, beta | 
| Calculated Molecular Weight | 418 aa, 46 kDa | 
| Observed Molecular Weight | 46-50 kDa | 
| GenBank Accession Number | BC075800 | 
| Gene Symbol | PRKAR2B | 
| Gene ID (NCBI) | 5577 | 
| RRID | AB_2918156 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P31323 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PRKAR2B antibody 28351-1-AP | Download protocol | 
| IHC protocol for PRKAR2B antibody 28351-1-AP | Download protocol | 
| IP protocol for PRKAR2B antibody 28351-1-AP | Download protocol | 
| WB protocol for PRKAR2B antibody 28351-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 

















