Tested Applications
| Positive WB detected in | mouse brain tissue, mouse kidney tissue, rat brain tissue, mouse lung tissue, rat lung tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 29 publications below |
| IHC | See 7 publications below |
Product Information
21646-1-AP targets PRKG1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16333 Product name: Recombinant human PRKG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC127090 Sequence: MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPG Predict reactive species |
| Full Name | protein kinase, cGMP-dependent, type I |
| Calculated Molecular Weight | 686 aa, 78 kDa |
| Observed Molecular Weight | 65-78 kDa |
| GenBank Accession Number | BC127090 |
| Gene Symbol | PRKG1 |
| Gene ID (NCBI) | 5592 |
| RRID | AB_2878897 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13976 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRKG1(cGMP-dependent protein kinase 1) is also named as cGK1, PRKG1B, PRKGR1A, PRKGR1B and belongs to the cGMP subfamily. It serves as an integral component of second messenger signaling in a number of biological contexts including cell differentiation, memory, and vasodilation(PMID:21893290). Its activity prevents pathological-level nitric oxide-induced apoptosis and promotes DNA synthesis/cell proliferation in vascular smooth muscle cells(PMID:20060325). PRKG1 has 2 isoforms produced by alternative splicing with the molecular weight of 76 kDa and 78 kDa. The autophosphorylation can increase the kinase activity and it can form a monomer with the molecular weight of 65 kDa that is produced by proteolytic cleavage. SDS-PAGE revealed that proteolysis generated two different monomers with molecular masses of 70 and 68 kDa of CGK1-beta(PMID:8702828).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PRKG1 antibody 21646-1-AP | Download protocol |
| IP protocol for PRKG1 antibody 21646-1-AP | Download protocol |
| WB protocol for PRKG1 antibody 21646-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Comput Struct Biotechnol J Integrating single-cell sequencing and clinical insights to explore malignant transformation in odontogenic keratocyst | ||
Environ Pollut Fluoride-induced unrestored arrest during haploid period of spermatogenesis via the regulation of DDX25 in rats. | ||
J Ethnopharmacol Systematic reevaluation on the antipyretic, analgesic effects, and uncover the mechanisms of Chaiqin Qingning capsule, a traditional Chinese medicine, via establishing lipopolysaccharide - induced fever models, physical and chemical - stimuli pain models | ||
Clin Sci (Lond) Empagliflozin prevents cardiomyopathy via sGC-cGMP-PKG pathway in type 2 diabetes mice. | ||
Front Cell Dev Biol Myostatin Mutation Promotes Glycolysis by Increasing Phosphorylation of Phosphofructokinase via Activation of PDE5A-cGMP-PKG in Cattle Heart.
| ||
Front Pharmacol Emodin Interferes With Nitroglycerin-Induced Migraine in Rats Through CGMP-PKG Pathway. |











