• Featured Product
  • KD/KO Validated

PRKG1 Polyclonal antibody

PRKG1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 21646-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IP, ELISA

CGKI, cGK1, PRKG1B, EC:2.7.11.12, cGMP-dependent protein kinase I

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse kidney tissue, rat brain tissue, mouse lung tissue, rat lung tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21646-1-AP targets PRKG1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16333

Product name: Recombinant human PRKG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-178 aa of BC127090

Sequence: MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPG

Predict reactive species
Full Name protein kinase, cGMP-dependent, type I
Calculated Molecular Weight 686 aa, 78 kDa
Observed Molecular Weight 65-78 kDa
GenBank Accession NumberBC127090
Gene Symbol PRKG1
Gene ID (NCBI) 5592
RRIDAB_2878897
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13976
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRKG1(cGMP-dependent protein kinase 1) is also named as cGK1, PRKG1B, PRKGR1A, PRKGR1B and belongs to the cGMP subfamily. It serves as an integral component of second messenger signaling in a number of biological contexts including cell differentiation, memory, and vasodilation(PMID:21893290). Its activity prevents pathological-level nitric oxide-induced apoptosis and promotes DNA synthesis/cell proliferation in vascular smooth muscle cells(PMID:20060325). PRKG1 has 2 isoforms produced by alternative splicing with the molecular weight of 76 kDa and 78 kDa. The autophosphorylation can increase the kinase activity and it can form a monomer with the molecular weight of 65 kDa that is produced by proteolytic cleavage. SDS-PAGE revealed that proteolysis generated two different monomers with molecular masses of 70 and 68 kDa of CGK1-beta(PMID:8702828).

Protocols

Product Specific Protocols
IHC protocol for PRKG1 antibody 21646-1-APDownload protocol
IP protocol for PRKG1 antibody 21646-1-APDownload protocol
WB protocol for PRKG1 antibody 21646-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Comput Struct Biotechnol J

Integrating single-cell sequencing and clinical insights to explore malignant transformation in odontogenic keratocyst

Authors - Guile Zhao
ratWB

Environ Pollut

Fluoride-induced unrestored arrest during haploid period of spermatogenesis via the regulation of DDX25 in rats.

Authors - Yongli Han

J Ethnopharmacol

Systematic reevaluation on the antipyretic, analgesic effects, and uncover the mechanisms of Chaiqin Qingning capsule, a traditional Chinese medicine, via establishing lipopolysaccharide - induced fever models, physical and chemical - stimuli pain models

Authors - Lianzhan Huang
mouseWB

Clin Sci (Lond)

Empagliflozin prevents cardiomyopathy via sGC-cGMP-PKG pathway in type 2 diabetes mice.

Authors - Mei Xue
bovineWB

Front Cell Dev Biol

Myostatin Mutation Promotes Glycolysis by Increasing Phosphorylation of Phosphofructokinase via Activation of PDE5A-cGMP-PKG in Cattle Heart.

Authors - Mingjuan Gu
  • KD Validated
ratWB

Front Pharmacol

Emodin Interferes With Nitroglycerin-Induced Migraine in Rats Through CGMP-PKG Pathway.

Authors - Shuding Sun
Loading...
||
New chat

Able

正在加载,请稍候...