PRL Recombinant monoclonal antibody, PBS Only

• 

  Affinity of 85765-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 85765-2-PBS against Human PRL was performed. The affinity constant is below 1 pM.

PRL Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85765-2-PBS

Clone No.242898B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

prolactin

---

Product Information

85765-2-PBS targets PRL in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9764

  Product name: Recombinant human PRL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-227 aa of BC015850

  Sequence: MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

• Full Name: prolactin
• Calculated Molecular Weight: 227 aa, 26 kDa
• GenBank Accession Number: BC015850
• Gene Symbol: Prolactin/PRL
• Gene ID (NCBI): 5617
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01236
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.