Tested Applications
| Positive WB detected in | HepG2 cells, Jurkat cells, SH-SY5Y cells, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24800-1-AP targets PRLHR in WB, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20098 Product name: Recombinant human PRLHR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC101490 Sequence: MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVV Predict reactive species |
| Full Name | prolactin releasing hormone receptor |
| Calculated Molecular Weight | 370 aa, 41 kDa |
| Observed Molecular Weight | 41 kDa |
| GenBank Accession Number | BC101490 |
| Gene Symbol | PRLHR |
| Gene ID (NCBI) | 2834 |
| RRID | AB_3669450 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49683 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRLHR (prolactin-releasing hormone receptor) is implicated in lactation, regulation of food intake, and pain-signal processing.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PRLHR antibody 24800-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

