Product Information
14500-1-PBS targets PRM2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5952 Product name: Recombinant human PRM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC066338 Sequence: MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH Predict reactive species |
| Full Name | protamine 2 |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 10-25 kDa |
| GenBank Accession Number | BC066338 |
| Gene Symbol | PRM2 |
| Gene ID (NCBI) | 5620 |
| RRID | AB_2721024 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04554 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PRM2 (Protamine-2) is the main DNA-binding protein in the sperm nucleus, consisting of a C-terminal mature PRM2 (mPRM2) domain and an N-terminal lytic PRM2 (cPRM2) domain, which is lyzed sequentially after binding to DNA. PRM2 plays an important role in spermatogenesis and development. PRM2 is specifically expressed in sperm and localized in the sperm nucleus.





