Tested Applications
| Positive WB detected in | human testis tissue |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14500-1-AP targets PRM2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5952 Product name: Recombinant human PRM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC066338 Sequence: MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH Predict reactive species |
| Full Name | protamine 2 |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 10-25 kDa |
| GenBank Accession Number | BC066338 |
| Gene Symbol | PRM2 |
| Gene ID (NCBI) | 5620 |
| RRID | AB_2721024 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04554 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRM2 (Protamine-2) is the main DNA-binding protein in the sperm nucleus, consisting of a C-terminal mature PRM2 (mPRM2) domain and an N-terminal lytic PRM2 (cPRM2) domain, which is lyzed sequentially after binding to DNA. PRM2 plays an important role in spermatogenesis and development. PRM2 is specifically expressed in sperm and localized in the sperm nucleus.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PRM2 antibody 14500-1-AP | Download protocol |
| WB protocol for PRM2 antibody 14500-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PRM2 Polyclonal antibody (Cat# 14500-1-AP) has 13 citations published in journals including Molecular Cell, Journal of Hazardous Materials, Environmental Pollution, Human Reproduction, Cell Biosciences, Communications Biology, Frontiers in Cell and Developmental Biology, Scientific Reports, Molecular Human Reproduction, Biology of Reproduction, and PeerJ. Research fields span spermatogenesis, sperm motility, male reproductive toxicity, testicular development, chromatin remodeling, and posttranslational modifications of sperm proteins.
| Species | Application | Title |
|---|---|---|
Mol Cell Chromodomain Protein CDYL Acts as a Crotonyl-CoA Hydratase to Regulate Histone Crotonylation and Spermatogenesis. | ||
J Hazard Mater Multi-omics analyses reveal the mechanisms of Arsenic-induced male reproductive toxicity in mice. | ||
Environ Pollut Silica nanoparticles inhibiting the differentiation of round spermatid and chromatin remodeling of haploid period via MIWI in mice. | ||
Environ Pollut Silica nanoparticles induce spermatogenesis disorders via L3MBTL2-DNA damage-p53 apoptosis and RNF8-ubH2A/ubH2B pathway in mice. | ||
Hum Reprod Posttranslational lysine 2-hydroxyisobutyrylation of human sperm tail proteins affects motility. | ||
