PRMT3 Polyclonal antibody, PBS Only

• 

  WB analysis using 17628-1-AP (same clone as 17628-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17628-1-AP (PRMT3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17628-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 17628-1-AP (same clone as 17628-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 17628-1-AP (PRMT3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17628-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 17628-1-AP (same clone as 17628-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 17628-1-AP (PRMT3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17628-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 17628-1-AP (same clone as 17628-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PRMT3 antibody (17628-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17628-1-PBS in a different storage buffer formulation.

PRMT3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17628-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Protein arginine N-methyltransferase 3, PRMT 3, HRMT1L3, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3, EC:2.1.1.319

---

Product Information

17628-1-PBS targets PRMT3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11877

  Product name: Recombinant human PRMT3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 178-531 aa of BC037544

  Sequence: RAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ

• Full Name: protein arginine methyltransferase 3
• Calculated Molecular Weight: 531 aa, 60 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC037544
• Gene Symbol: PRMT3
• Gene ID (NCBI): 10196
• RRID: AB_2171654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60678
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRMT3(protein arginine methyltransferase 3) regulates protein functions by introducing asymmetric dimethylation marks at the arginine residues in proteins.