PRMT3 Polyclonal antibody

PRMT3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 17628-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Protein arginine N-methyltransferase 3, PRMT 3, HRMT1L3, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3, EC:2.1.1.319

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, mouse brain tissue, mouse liver tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17628-1-AP targets PRMT3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11877

Product name: Recombinant human PRMT3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 178-531 aa of BC037544

Sequence: RAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ

Predict reactive species
Full Name protein arginine methyltransferase 3
Calculated Molecular Weight 531 aa, 60 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC037544
Gene Symbol PRMT3
Gene ID (NCBI) 10196
RRIDAB_2171654
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60678
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRMT3(protein arginine methyltransferase 3) regulates protein functions by introducing asymmetric dimethylation marks at the arginine residues in proteins.

Protocols

Product Specific Protocols
IF protocol for PRMT3 antibody 17628-1-APDownload protocol
IHC protocol for PRMT3 antibody 17628-1-APDownload protocol
WB protocol for PRMT3 antibody 17628-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IHC

Mol Med

PRMT3 methylates HIF-1α to enhance the vascular calcification induced by chronic kidney disease

Authors - Guangyu Zhou
humanWB

Toxicol Appl Pharmacol

Ribavirin inhibits the growth and ascites formation of hepatocellular carcinoma through downregulation of type I CARM1 and type II PRMT5

Authors - Yizhen Tian
human,mouseWB

Basic Clin Pharmacol Toxicol

Ribavirin inhibits cell proliferation and metastasis and prolongs survival in soft tissue sarcomas by downregulating both protein arginine methyltransferases 1 and 5.

Authors - Qingqing Zhang
mouseWB

Biomed Res

Shotgun proteomic investigation of methyltransferase and methylation profiles in lipopolysaccharide stimulated RAW264.7 murine macrophages.

Authors - Yumi Aizawa
chickenWB,IF

Poult Sci

Chicken PRMT3 facilitates IBDV replication

Authors - Zhixuan Xiong
  • KD Validated
humanWB,IF

Nat Commun

Targeting PRMT3 impairs methylation and oligomerization of HSP60 to boost anti-tumor immunity by activating cGAS/STING signaling

Authors - Yunxing Shi
Loading...
||
New chat Able
正在加载,请稍候...