PRMT3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PRMT3 Polyclonal antibody (17628-1-AP)

PRMT3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17628-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Protein arginine N-methyltransferase 3, PRMT 3, HRMT1L3, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3, EC:2.1.1.319

• 

  WB analysis using 17628-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17628-1-AP (PRMT3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 17628-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 17628-1-AP (PRMT3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 17628-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 17628-1-AP (PRMT3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 17628-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PRMT3 antibody (17628-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PRMT3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue, mouse liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17628-1-AP targets PRMT3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11877

  Product name: Recombinant human PRMT3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 178-531 aa of BC037544

  Sequence: RAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ

• Full Name: protein arginine methyltransferase 3
• Calculated Molecular Weight: 531 aa, 60 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC037544
• Gene Symbol: PRMT3
• Gene ID (NCBI): 10196
• RRID: AB_2171654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60678
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRMT3(protein arginine methyltransferase 3) regulates protein functions by introducing asymmetric dimethylation marks at the arginine residues in proteins.

Publications

What published studies show

PRMT3 Polyclonal antibody (Cat# 17628-1-AP) has 12 citations published in journals including Blood, Nature Communications, Advanced Science, Molecular Medicine, Journal of Medicinal Chemistry, Biochemical Pharmacology, Poultry Science, Basic & Clinical Pharmacology & Toxicology, Toxicology & Applied Pharmacology, Biomedical Research, and PLoS Pathogens. Research fields span oncology (AML, rectal cancer, sarcoma, HCC), metabolism, immunology, vascular biology, virology, pharmacology, and arginine methylation.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Blood; Targeting PRMT9 Overcomes Venetoclax Resistance in AML by Modulating Splicing and Inhibiting Translation; Authors - Yang Li
mouse	WB	Nat Commun; PRMT3-mediated post-translational adaptation to fasting regulates metabolic flexibility.; Authors - Zhengyun Huang
human	WB,IF	Nat Commun; Targeting PRMT3 impairs methylation and oligomerization of HSP60 to boost anti-tumor immunity by activating cGAS/STING signaling; Authors - Yunxing Shi
human	IF	Adv Sci (Weinh); Dynamic Arginine Methylation of YBX1 Relay Controls Its Phase Separation and Chemoradiotherapy Resistance in Rectal Cancer.; Authors - Yunxing Shi
mouse	WB,IHC	Mol Med; PRMT3 methylates HIF-1α to enhance the vascular calcification induced by chronic kidney disease; Authors - Guangyu Zhou
human	WB	J Med Chem; Discovery of the First-in-Class Protein Arginine Methyltransferase 1 PROTAC Degrader.; Authors - Siqi Guo