PRMT3 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00892-4

  Sandwich ELISA standard curve of MP00892-4, Human PRMT3 Recombinant Matched Antibody Pair - PBS only. 83969-8-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag13466. 83969-4-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL

• 

  Sample test of MP00892-4

  A549, HepG2 and HEK-293 cell lysate were measured. The human PRMT3 concentration of detected samples was determined to be 22.38 ng/mL (based on a 1.0 mg/mL extract load) in A549 cell lyaste, 9.39 ng/mL (based on a 1.2 mg/mL extract load) in HepG2 cell lyaste and 45.68 ng/mL (based on a 1.2 mg/mL extract load) in HEK-293 cell lysate.

PRMT3 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83969-8-PBS

Clone No.241092B10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Protein arginine N-methyltransferase 3, PRMT 3, HRMT1L3, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3, EC:2.1.1.319

---

Product Information

83969-8-PBS targets PRMT3 as part of a matched antibody pair:

MP00892-4: 83969-8-PBS capture and 83969-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13466

  Product name: Recombinant human PRMT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 178-531 aa of BC037544

  Sequence: RAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ

• Full Name: protein arginine methyltransferase 3
• Calculated Molecular Weight: 531 aa, 60 kDa
• GenBank Accession Number: BC037544
• Gene Symbol: PRMT3
• Gene ID (NCBI): 10196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60678
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.