PRMT8 Polyclonal antibody, PBS Only

• 

  WB analysis of Y79 using 12557-1-AP (same clone as 12557-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 12557-1-AP (PRMT8 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 12557-1-AP (same clone as 12557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12557-1-AP (PRMT8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12557-1-AP (same clone as 12557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12557-1-AP (PRMT8 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12557-1-AP (same clone as 12557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12557-1-AP (PRMT8 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12557-1-AP (same clone as 12557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12557-1-AP (PRMT8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12557-1-PBS in a different storage buffer formulation.

PRMT8 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12557-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12557-1-PBS targets PRMT8 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3166

  Product name: Recombinant human PRMT8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 95-394 aa of BC022458

  Sequence: RTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSQKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR

• Full Name: protein arginine methyltransferase 8
• Calculated Molecular Weight: 394 aa, 45 kDa
• Observed Molecular Weight: 43-50 kDa
• GenBank Accession Number: BC022458
• Gene Symbol: PRMT8
• Gene ID (NCBI): 56341
• RRID: AB_2171964
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR22
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRMT8 is a member of arginine methyl transferase (PRMT) family which acts as nuclear receptor coactivators. PRMT8 catalyzes the asymmetric arginine methylation and is involved in cellular differentiation. PRMT8 has several isoforms; the full-length isoform has a brain specific expression pattern and is localized to the plasma membrane; the truncated isoforms display nuclear localization and are expressed more widely. This antibody recognizes all of isoforms of PRMT8.