PRODH Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PRODH Polyclonal antibody (22980-1-AP)

• Featured Product
• KD/KO Validated

PRODH Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22980-1-AP

Publications(22)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

HSPOX2, p53 induced gene 6 protein, PIG6, POX, POX2, PRODH, PRODH1, Proline oxidase, Proline oxidase 2, SCZD4, TP53I6

• 

  WB analysis using 22980-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22980-1-AP (PRODH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22980-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22980-1-AP (PRODH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22980-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22980-1-AP (PRODH antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 22980-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum slide using 22980-1-AP (PRODH Antibody) at dilution of 1:50(under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 22980-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum slide using 22980-1-AP (PRODH Antibody) at dilution of 1:50(under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 22980-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 22980-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 22980-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 22980-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 22980-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 22980-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 22980-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 22980-1-AP (PRODH Antibody) at dilution of 1:50(under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 22980-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 22980-1-AP (PRODH Antibody) at dilution of 1:50(under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse liver tissue, A549 cells, rat liver tissue
• Positive IHC detected in: human cerebellum tissue, human liver cancer tissue, human breast cancer tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22980-1-AP targets PRODH in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18429

  Product name: Recombinant human PRODH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 143-492 aa of BC118597

  Sequence: LAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGIASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRPA

• Full Name: proline dehydrogenase (oxidase) 1
• Calculated Molecular Weight: 600 aa, 68 kDa
• Observed Molecular Weight: 56 kDa, 66 kDa
• GenBank Accession Number: BC118597
• Gene Symbol: PRODH
• Gene ID (NCBI): 5625
• RRID: AB_2879191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43272
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRODH(Proline dehydrogenase 1, mitochondrial) is also named as PIG6, HSPOX2, PRODH1, PRODH2, POX, SCZD4, TP53I6 and belongs to the proline oxidase family. It is an oxidoreductase involved in the transfer of redox potential across the mitochondrial membrane and catalyzes the rate-limiting oxidation of proline to pyrroline- 5-carboxylate (P5C). High PRODH activity is sufficient to induce mitochondria-mediated apoptosis in the presence of proline. Defects in PRODH are the cause of hyperprolinemia type 1 (HP-1) and defects in PRODH are associated with susceptibility to schizophrenia type 4 (SCZD4). This protein has 3 isoforms produced by alternative splicing with the molecular mass of 68 kDa, 59 kDa and 56 kDa.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Kindlin-2 links mechano-environment to proline synthesis and tumor growth.; Authors - Ling Guo
mouse	WB	Redox Biol; Impaired xCT-mediated cystine uptake drives serine and proline metabolic reprogramming and mitochondrial fission in skeletal muscle cells.; Authors - Michel N. Kanaan
mouse	WB	Nucleic Acids Res; Discordant regulation of eIF2 kinase GCN2 and mTORC1 during nutrient stress.; Authors - Jagannath Misra
human,mouse	WB	Adv Sci (Weinh); Connexin43 Deficiency Leads to Ventricular Arrhythmias by Reprogramming Proline Metabolism.; Authors - Hangying Ying
mouse	WB	Authors -
human,mouse	WB,IF,IHC	Cell Death Discov; Mechanical stiffness promotes skin fibrosis through Piezo1-mediated arginine and proline metabolism; Authors - Jiahao He