CD133 Polyclonal antibody

• 

  WB analysis using 18470-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18470-1-AP (CD133 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 18470-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 18470-1-AP (PROM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 18470-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 18470-1-AP (PROM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-29 using 18470-1-AP

  HT-29 cells were subjected to SDS PAGE followed by western blot with 18470-1-AP (CD133 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18470-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18470-1-AP (CD133 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 18470-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18470-1-AP (CD133 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 18470-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18470-1-AP (CD133 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse kidney using 18470-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using CD133 antibody (18470-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

CD133 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 18470-1-AP

Publications(264)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

AC133, Antigen AC133, CORD12, MCDR2, MSTP061

---

Tested Applications

• Positive WB detected in: HT-29 cells, mouse kidney tissue, mouse pancreas tissue, rat kidney tissue, Caco-2 cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:4000-1:16000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 178 publications below
• IHC: See 58 publications below
• IF: See 56 publications below

Product Information

18470-1-AP targets CD133 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13328

  Product name: Recombinant human CD133 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 806-856 aa of BC012089

  Sequence: LAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNPVMTSPSQH

• Full Name: prominin 1
• Calculated Molecular Weight: 97 kDa
• Observed Molecular Weight: 115 kDa-120 kDa
• GenBank Accession Number: BC012089
• Gene Symbol: CD133
• Gene ID (NCBI): 8842
• RRID: AB_2172859
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43490
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; Merkel cell polyomavirus activates LSD1-mediated blockade of non-canonical BAF to regulate transformation and tumorigenesis.; Authors - Donglim Esther Park
human	WB	Adv Sci (Weinh); Exosomal CCT6A Secreted by Cancer-Associated Fibroblasts Interacts with β-Catenin to Enhance Chemoresistance and Tumorigenesis in Gastric Cancer; Authors - Hui Sun
human	WB	Cell Rep Med; CD97 maintains tumorigenicity of glioblastoma stem cells via mTORC2 signaling and is targeted by CAR Th9 cells; Authors - Shuchang Zhou
human	WB	Cell Death Differ; CRSP8 promotes thyroid cancer progression by antagonizing IKKα-induced cell differentiation.; Authors - Yina Liao
human	WB	J Pineal Res; Melatonin inhibits the stemness of head and neck squamous cell carcinoma by modulating HA synthesis via the FOSL1/HAS3 axis; Authors - Xinyue Luo
rat		Mater Today Bio; Endoscopic nasal delivery of engineered endothelial progenitor cell-derived exosomes improves angiogenesis and neurological deficits in rats with intracerebral hemorrhage; Authors - Gui Wan