Tested Applications
| Positive IF-P detected in | mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-18470 targets CD133 in IF-P applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13328 Product name: Recombinant human CD133 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 806-856 aa of BC012089 Sequence: LAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNPVMTSPSQH Predict reactive species |
| Full Name | prominin 1 |
| Calculated Molecular Weight | 97 kDa |
| Observed Molecular Weight | |
| GenBank Accession Number | BC012089 |
| Gene Symbol | CD133 |
| Gene ID (NCBI) | 8842 |
| RRID | AB_2919847 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43490 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 CD133 antibody CL594-18470 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Mater Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment | ||
Anal Chem Time-Resolved Quantification of Single-Cell Extracellular Vesicles Secretion for Drug Resistance Evaluation |



