PR3/PRTN3 Monoclonal antibody, PBS Only

• 

  WB analysis of human placenta using 67030-1-Ig (same clone as 67030-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67030-1-Ig (PRTN3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67030-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 67030-1-Ig (same clone as 67030-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 67030-1-Ig (PRTN3 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67030-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 67030-1-Ig (same clone as 67030-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 67030-1-Ig (PRTN3 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67030-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67030-1-Ig (same clone as 67030-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67030-1-Ig (PRTN3 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67030-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67030-1-Ig (same clone as 67030-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67030-1-Ig (PRTN3 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67030-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 67030-1-Ig (same clone as 67030-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using PRTN3 antibody (67030-1-Ig, Clone: 2D1B8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67030-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 67030-1-Ig (same clone as 67030-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using PRTN3 antibody (67030-1-Ig, Clone: 2D1B8 ) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-3). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67030-1-PBS in a different storage buffer formulation.

PR3/PRTN3 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67030-1-PBS

Clone No.2D1B8

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

PRTN3, NP-4, Myeloblastin, MBN, EC:3.4.21.76

---

Product Information

67030-1-PBS targets PR3/PRTN3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25915

  Product name: Recombinant human PRTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 89-150 aa of BC096183

  Sequence: NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT

• Full Name: proteinase 3
• Calculated Molecular Weight: 256 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC096183
• Gene Symbol: PRTN3
• Gene ID (NCBI): 5657
• RRID: AB_2882345
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24158
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.