Product Information
67030-1-PBS targets PR3/PRTN3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25915 Product name: Recombinant human PRTN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 89-150 aa of BC096183 Sequence: NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT Predict reactive species |
Full Name | proteinase 3 |
Calculated Molecular Weight | 256 aa, 28 kDa |
Observed Molecular Weight | 28 kDa |
GenBank Accession Number | BC096183 |
Gene Symbol | PRTN3 |
Gene ID (NCBI) | 5657 |
RRID | AB_2882345 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P24158 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |