Tested Applications
Positive WB detected in | HepG2 cells, human liver tissue |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
18396-1-AP targets PSAP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13263 Product name: Recombinant human PSAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 61-143 aa of BC001503 Sequence: LPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQK Predict reactive species |
Full Name | prosaposin |
Calculated Molecular Weight | 58 kDa |
Observed Molecular Weight | 60-70 kDa |
GenBank Accession Number | BC001503 |
Gene Symbol | PSAP |
Gene ID (NCBI) | 5660 |
RRID | AB_2172460 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P07602 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The PSAP gene encodes prosaposin, a precursor of fourl small nonenzymatic glycoproteins termed 'sphingolipid activator proteins' (SAPs) that assist in the lysosomal hydrolysis of sphingolipids. After proteolytic processing of the presaposin protein, these 4 released polypeptides are functional activators. Saposin A was encoded by residues 60 to 143 of PSAP, saposin B by 195 to 275, saposin C by 311 to 390, and saposin D by 405 to 487. There are four 12-14 kDa heatstable glycoproteins. This antibody should recognize saposin A.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PSAP antibody 18396-1-AP | Download protocol |
IHC protocol for PSAP antibody 18396-1-AP | Download protocol |
IF protocol for PSAP antibody 18396-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |