PSCA Polyclonal antibody

• 

  WB analysis of PC-3 using 17171-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 17171-1-AP (PSCA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 17171-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17171-1-AP (PSCA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PSCA Polyclonal Antibody for WB, ELISA

Cat No. 17171-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

PRO232, prostate stem cell antigen, PSCA

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, PC-3 cells, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below

Product Information

17171-1-AP targets PSCA in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10710

  Product name: Recombinant human PSCA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC023582

  Sequence: MKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHAL

• Full Name: prostate stem cell antigen
• Calculated Molecular Weight: 123 aa, 13 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC023582
• Gene Symbol: PSCA
• Gene ID (NCBI): 8000
• RRID: AB_2172635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43653
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prostate stem cell antigen (PSCA) is a protein composed of 123 amino acid residues. PSCA belongs to the LY-6/Thy-1 family of cell surface antigens. It is highly expressed in normal prostate and further up-regulated in prostate cancer, as well as non-prostatic malignancies including gastric cancer. PSCA plays a critical role in cell adhesion, proliferation, and survival. The obasrved MW of PSCA is between 36 to 40 kDa in paper (PMID: 11309275).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Endocrinology; mTOR regulates mineralocorticoid receptor transcriptional activity by ULK1- dependent and independent mechanisms; Authors - Yusuf Ali
human	WB	PLoS One; Pan-cancer analysis of PSCA that is associated with immune infiltration and affects patient prognosis; Authors - Chenxing Wang ; KD Validated
mouse	WB	J Immunother Cancer; Impact of tumor localization on antitumor immunity with conditionally activated CTLA-4 blockade; Authors - Marcel Arias-Badia