Tested Applications
| Positive WB detected in | HeLa cells, HCT 116 cells, HepG2 cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30580-1-AP targets PSMA5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30703 Product name: Recombinant human PSMA5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 120-241 aa of NM_002790 Sequence: ALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI Predict reactive species |
| Full Name | proteasome (prosome, macropain) subunit, alpha type, 5 |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | NM_002790 |
| Gene Symbol | PSMA5 |
| Gene ID (NCBI) | 5686 |
| RRID | AB_3086368 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P28066 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Proteasome subunit alpha type-5(PSMA5) is a component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. It binds to two 19S regulatory particles(RP) to form the 26S proteasome, an ATP-dependent multisubunit protease that degrades polyubiquitinated proteins into small peptides.(PMID: 26661102)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PSMA5 antibody 30580-1-AP | Download protocol |
| IHC protocol for PSMA5 antibody 30580-1-AP | Download protocol |
| WB protocol for PSMA5 antibody 30580-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





