Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PSMB8 Polyclonal antibody

PSMB8 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA
For FC, select conjugated version.

EC:3.4.25.1, LMP7, Proteasome subunit beta type 8, Proteasome subunit beta type-8, Proteasome subunit beta-5i

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PSMB8 in ?

Tested Applications

Positive WB detected inJurkat cells, human kidney tissue
Positive IP detected inRaji cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14859-1-AP targets PSMB8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6660

Product name: Recombinant human PSMB8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-272 aa of BC001114

Sequence: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

Predict reactive species
Full Name proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC001114
Gene Symbol PSMB8
Gene ID (NCBI) 5696
RRIDAB_2268923
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP28062
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMB8(Proteasome subunit beta type-8) is also named as LMP7, PSMB5i, RING10, Y2 and belongs to the peptidase T1B family. The gene encodes the chymotrypsin-like catalytic subunit of the immunoproteasome(PMID: 19525961). PSMB8 has a role in controlling pathogenic immune responses and may be a target in autoimmune disorders. Its prosequence is not essential for incorporation of PSMB8 into the maturing proteasome, but it increased the efficiency of PSMB8 incorporation and proteasome maturation(PMID: 10926487). The pro-PSMB8 is a 276aa protein with the molecular mass of 30 kDa, and the mature form is about 23kDa due to the 72aa propeptide cleaved. Defects in PSMB8 are the cause of Nakajo syndrome (NKJO).

Protocols

Product Specific Protocols
IF protocol for PSMB8 antibody 14859-1-APDownload protocol
IP protocol for PSMB8 antibody 14859-1-APDownload protocol
WB protocol for PSMB8 antibody 14859-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-PSMB8 (LMP7) antibody (Cat# 14859-1-AP) has 21 citations across journals including Cell, Cell Reports, Journal of Neuroinflammation, Journal of Translational Medicine, Frontiers in Immunology, JCI Insight, Science Reports, International Journal of Cancer, and American Journal of Pathology. Research fields span neuroimmunology (multiple sclerosis, EAE), oncology (bladder, pancreatic, thyroid, breast cancer), inflammatory diseases (ulcerative colitis, airway inflammation), proteasome biology, T cell immunology, nephrology, and dermatology.

SpeciesApplicationTitle
humanWB

Cell

EBV infection and HLA-DR15 jointly drive multiple sclerosis by myelin peptide presentation.

Authors - Jian Wang
mouseWB

J Neuroinflammation

β-arrestin1 regulates astrocytic reactivity via Drp1-dependent mitochondrial fission: implications in postoperative delirium

Authors - Fuzhou Hua
humanIHC

J Transl Med

Immunoproteasome subunits are novel signatures for predicting efficacy of immunotherapy in muscle invasive bladder cancer

Authors - XinJian Wang

ACS Appl Mater Interfaces

An Astrocyte-Targeted Nanoplatform with Ultrasound-Responsive Fluorescence Switch for Synergistic Chemo-Sonothermal Therapy of Cognitive Impairment.

Authors - Zengjin Wang
humanWB

Cell Rep

Neuronal hyperactivity becomes mTORC1 independent due to transcriptional changes in tuberous sclerosis complex disease models.

Authors - Wardiya Afshar-Saber

Cell Rep

ECM29/proteasome-mediated self-antigen generation by CNS-resident neuroglia promotes regulatory T cell activation

Authors - Sheng-Wen Chen
Loading...
||
New chat

Able™

正在加载,请稍候...