• Featured Product
  • KD/KO Validated

PSMB8 Polyclonal antibody

PSMB8 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 14859-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

EC:3.4.25.1, LMP7, Proteasome subunit beta type 8, Proteasome subunit beta type-8, Proteasome subunit beta-5i

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, mouse kidney tissue, human kidney tissue
Positive IP detected inRaji cells
Positive IHC detected inmouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14859-1-AP targets PSMB8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6660

Product name: Recombinant human PSMB8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-272 aa of BC001114

Sequence: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

Predict reactive species
Full Name proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC001114
Gene Symbol PSMB8
Gene ID (NCBI) 5696
RRIDAB_2268923
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP28062
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMB8(Proteasome subunit beta type-8) is also named as LMP7, PSMB5i, RING10, Y2 and belongs to the peptidase T1B family. The gene encodes the chymotrypsin-like catalytic subunit of the immunoproteasome(PMID: 19525961). PSMB8 has a role in controlling pathogenic immune responses and may be a target in autoimmune disorders. Its prosequence is not essential for incorporation of PSMB8 into the maturing proteasome, but it increased the efficiency of PSMB8 incorporation and proteasome maturation(PMID: 10926487). The pro-PSMB8 is a 276aa protein with the molecular mass of 30 kDa, and the mature form is about 23kDa due to the 72aa propeptide cleaved. Defects in PSMB8 are the cause of Nakajo syndrome (NKJO).

Protocols

Product Specific Protocols
IF protocol for PSMB8 antibody 14859-1-APDownload protocol
IHC protocol for PSMB8 antibody 14859-1-APDownload protocol
IP protocol for PSMB8 antibody 14859-1-APDownload protocol
WB protocol for PSMB8 antibody 14859-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Cell Rep

ECM29/proteasome-mediated self-antigen generation by CNS-resident neuroglia promotes regulatory T cell activation

Authors - Sheng-Wen Chen
mouse,humanWB

Int J Cancer

Antitumor efficacy of intermittent low-dose erlotinib plus sulindac via MHC upregulation and remodeling of the immune cell niche

Authors - Chakrapani Tripathi
humanWB

J Cell Mol Med

miR-451a inhibits cancer growth, epithelial-mesenchymal transition and induces apoptosis in papillary thyroid cancer by targeting PSMB8.

Authors - Xinlong Fan
mouseWB,IHC

J Biol Chem

PITHD1 is a proteasome-interacting protein essential for male fertilization.

Authors - Hiroyuki Kondo
mouseWB

JCI Insight

Blockade of the CXCR3/CXCL10 axis ameliorates inflammation caused by immunoproteasome dysfunction.

Authors - Yuki Sasaki
mouse,humanWB

Sci Rep

Airway epithelial immunoproteasome subunit LMP7 protects against rhinovirus infection

Authors - Kris Genelyn Dimasuay
  • KO Validated
Loading...
||
New chat Able
正在加载,请稍候...