PSMD14/POH1 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of A375 using 84767-4-RR (same clone as 84767-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using PSMD14 antibody (84767-4-RR, Clone: 242160H6 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84767-4-PBS in a different storage buffer formulation.

PSMD14/POH1 Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 84767-4-PBS

Clone No.242160H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

PSMD14, POH1, PAD1, EC:3.4.19.-, 26S proteasome-associated PAD1 homolog 1

---

Product Information

84767-4-PBS targets PSMD14/POH1 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2694

  Product name: Recombinant human PSMD14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC009524

  Sequence: MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

• Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: BC009524
• Gene Symbol: PSMD14
• Gene ID (NCBI): 10213
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O00487
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The PSMD14 (POH1, also known as Rpn11/MPR1/S13/CepP1) protein is a metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. PSMD14 is highly expressed in the heart and skeletal muscle. In carcinoma cell lines. down-regulation of PSMD14 by siRNA transfection considerably impacted cell viability, causing cell arrest in the G0-G1 phase, ultimately leading to senescence.