Product Information
84767-4-PBS targets PSMD14/POH1 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag2694 Product name: Recombinant human PSMD14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC009524 Sequence: MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK Predict reactive species |
Full Name | proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
Calculated Molecular Weight | 35 kDa |
GenBank Accession Number | BC009524 |
Gene Symbol | PSMD14 |
Gene ID (NCBI) | 10213 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | O00487 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
The PSMD14 (POH1, also known as Rpn11/MPR1/S13/CepP1) protein is a metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. PSMD14 is highly expressed in the heart and skeletal muscle. In carcinoma cell lines. down-regulation of PSMD14 by siRNA transfection considerably impacted cell viability, causing cell arrest in the G0-G1 phase, ultimately leading to senescence.