PSMD2 Monoclonal antibody, PBS Only

PSMD2 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67770-1-PBS
Clone No.1G7G5

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

TRAP2, S2, Rpn1, P97, 26S proteasome non-ATPase regulatory subunit 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67770-1-PBS targets PSMD2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6543

Product name: Recombinant human PSMD2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 561-908 aa of BC002368

Sequence: GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL

Predict reactive species
Full Name proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
Calculated Molecular Weight 100 kDa
Observed Molecular Weight100 kDa
GenBank Accession NumberBC002368
Gene Symbol PSMD2
Gene ID (NCBI) 5708
RRIDAB_2918536
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13200
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Tumor necrosis factor type 1 receptor-associated protein 2 (TRAP2), encoded by PSMD2 gene, is a non-ATPase regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. TRAP2 may also participate in the TNF signalling pathway since it interacts with the tumor necrosis factor type 1 receptor.

Loading...
||
New chat Able
正在加载,请稍候...