PSMD2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67770-1-Ig (same clone as 67770-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67770-1-Ig (PSMD2 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67770-1-PBS in a different storage buffer formulation.

PSMD2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67770-1-PBS

Clone No.1G7G5

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

TRAP2, S2, Rpn1, P97, 26S proteasome non-ATPase regulatory subunit 2

---

Product Information

67770-1-PBS targets PSMD2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6543

  Product name: Recombinant human PSMD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 561-908 aa of BC002368

  Sequence: GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL

• Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
• Calculated Molecular Weight: 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC002368
• Gene Symbol: PSMD2
• Gene ID (NCBI): 5708
• RRID: AB_2918536
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13200
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tumor necrosis factor type 1 receptor-associated protein 2 (TRAP2), encoded by PSMD2 gene, is a non-ATPase regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. TRAP2 may also participate in the TNF signalling pathway since it interacts with the tumor necrosis factor type 1 receptor.