PSMD2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PSMD2 Monoclonal antibody (67770-1-Ig)

PSMD2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67770-1-Ig

Clone No.1G7G5

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1G7G5, 26S proteasome non-ATPase regulatory subunit 2, P97, Rpn1, S2

• 

  WB analysis using 67770-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67770-1-Ig (PSMD2 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 67770-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67770-1-Ig (PSMD2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 67770-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 67770-1-Ig (PSMD2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 67770-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 67770-1-Ig (PSMD2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 67770-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67770-1-Ig (PSMD2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 67770-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 67770-1-Ig (PSMD2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 67770-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 67770-1-Ig (PSMD2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat lung using 67770-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 67770-1-Ig (PSMD2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 67770-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 67770-1-Ig (PSMD2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 67770-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using PSMD2 antibody (67770-1-Ig, Clone: 1G7G5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
• Positive IHC detected in: human placenta tissue, mouse kidney tissue, human lung tissue, mouse lung tissue, mouse stomach tissue, rat kidney tissue, rat lung tissue, rat stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67770-1-Ig targets PSMD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6543

  Product name: Recombinant human PSMD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 561-908 aa of BC002368

  Sequence: GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL

• Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
• Calculated Molecular Weight: 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC002368
• Gene Symbol: PSMD2
• Gene ID (NCBI): 5708
• RRID: AB_2918536
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13200
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tumor necrosis factor type 1 receptor-associated protein 2 (TRAP2), encoded by PSMD2 gene, is a non-ATPase regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. TRAP2 may also participate in the TNF signalling pathway since it interacts with the tumor necrosis factor type 1 receptor.