• Featured Product
  • KD/KO Validated

PSME1 Monoclonal antibody, PBS Only

PSME1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 67928-1-PBS
Clone No.1F7E2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

REG-alpha, PA28A, Interferon gamma up-regulated I-5111 protein, IGUP I-5111, IFI5111

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67928-1-PBS targets PSME1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30549

Product name: Recombinant human PSME1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-249 aa of BC007503

Sequence: MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

Predict reactive species
Full Name proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
Calculated Molecular Weight 29 kDa
Observed Molecular Weight29 kDa
GenBank Accession NumberBC007503
Gene Symbol PSME1
Gene ID (NCBI) 5720
RRIDAB_2918680
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ06323
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The principal function of the proteasome is targeted degradation of intracellular proteins. Activity of the 20S proteasome is controlled by regulatory complexes that bind to the ends of the cylindrical proteasome. 11S regulator (REG or PA28), is a complex of 28 kDa subunits that is thought to activate proteasomes toward the production of antigenic peptides. Human PSME1 and PSME2 genes encode the two proteasome activators PA28 alpha and beta, respectively, which have been implicated in antigen processing for loading class I MHC molecules. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.

Loading...
||
New chat Able
正在加载,请稍候...