PTAFR Polyclonal antibody, PBS Only

• 

  IHC staining of human lung using 20921-1-AP (same clone as 20921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 20921-1-AP (PTAFR Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 20921-1-AP (same clone as 20921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 20921-1-AP (PTAFR Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 20921-1-AP (same clone as 20921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 20921-1-AP (PTAFR Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 20921-1-AP (same clone as 20921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 20921-1-AP (PTAFR Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20921-1-PBS in a different storage buffer formulation.

PTAFR Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 20921-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

20921-1-PBS targets PTAFR in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15128

  Product name: Recombinant human PTAFR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 245-342 aa of BC013816

  Sequence: FVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKFRKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN

• Full Name: platelet-activating factor receptor
• Calculated Molecular Weight: 342 aa, 39 kDa
• GenBank Accession Number: BC013816
• Gene Symbol: PTAFR
• Gene ID (NCBI): 5724
• RRID: AB_2878766
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25105
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.