Tested Applications
Positive IHC detected in | human lung tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
20921-1-AP targets PTAFR in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15128 Product name: Recombinant human PTAFR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 245-342 aa of BC013816 Sequence: FVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKFRKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN Predict reactive species |
Full Name | platelet-activating factor receptor |
Calculated Molecular Weight | 342 aa, 39 kDa |
GenBank Accession Number | BC013816 |
Gene Symbol | PTAFR |
Gene ID (NCBI) | 5724 |
RRID | AB_2878766 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P25105 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for PTAFR antibody 20921-1-AP | Download protocol |
FC protocol for PTAFR antibody 20921-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Struct Mol Biol Structural basis for signal recognition and transduction by platelet-activating-factor receptor. | ||
Gut Pathog Virulence factors and mechanisms of paediatric pneumonia caused by Enterococcus faecalis |