PTGIR Polyclonal antibody

• 

  WB analysis using 30657-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30657-1-AP (PTGIR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PTGIR Polyclonal Antibody for WB, ELISA

Cat No. 30657-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Prostanoid IP receptor, Prostaglandin I2 receptor, Prostacyclin receptor, PRIPR, PGI2 receptor

---

Tested Applications

• Positive WB detected in: HepG2 cells, SGC-7901 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30657-1-AP targets PTGIR in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30653

  Product name: Recombinant human PTGIR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 296-386 aa of BC075814

  Sequence: RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC

• Full Name: prostaglandin I2 (prostacyclin) receptor (IP)
• Calculated Molecular Weight: 386 aa, 41 kDa
• Observed Molecular Weight: 41-45kDa
• GenBank Accession Number: BC075814
• Gene Symbol: PTGIR
• Gene ID (NCBI): 5739
• RRID: AB_3669746
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43119
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prostaglandin I2 receptor (PTGIR), also known as IP, is a seven-transmembrane receptor that binds G proteins leading to activation of adenylyl cyclase and an increase in cAMP formation. PTGIR is involved in insulin secretion in pancreatic beta-cells and in permselectivity in glomerular podocytes.