PTGIR Polyclonal antibody, PBS Only

• 

  WB analysis using 30657-1-AP (same clone as 30657-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30657-1-AP (PTGIR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30657-1-PBS in a different storage buffer formulation.

PTGIR Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30657-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30657-1-PBS targets PTGIR in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30653

  Product name: Recombinant human PTGIR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 296-386 aa of BC075814

  Sequence: RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC

• Full Name: prostaglandin I2 (prostacyclin) receptor (IP)
• Calculated Molecular Weight: 386 aa, 41 kDa
• Observed Molecular Weight: 41-45kDa
• GenBank Accession Number: BC075814
• Gene Symbol: PTGIR
• Gene ID (NCBI): 5739
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43119
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Prostaglandin I2 receptor (PTGIR), also known as IP, is a seven-transmembrane receptor that binds G proteins leading to activation of adenylyl cyclase and an increase in cAMP formation. PTGIR is involved in insulin secretion in pancreatic beta-cells and in permselectivity in glomerular podocytes.