Tested Applications
| Positive WB detected in | A431 cells, Neuro-2a cells, HeLa cells, THP-1 cells, C2C12 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13393-1-AP targets COX-1/Cyclooxygenase-1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4055 Product name: Recombinant human PTGS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-599 aa of BC029840 Sequence: KLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL Predict reactive species |
| Full Name | prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) |
| Calculated Molecular Weight | 599 aa, 69 kDa |
| Observed Molecular Weight | 60-72 kDa |
| GenBank Accession Number | BC029840 |
| Gene Symbol | PTGS1 |
| Gene ID (NCBI) | 5742 |
| RRID | AB_10644323 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23219 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PTGS1(Prostaglandin G/H synthase 1) belongs to the prostaglandin G/H synthase family and catalyzes the conversion of arachidonic acid to prostaglandin H2, which is subsequently metabolized to various biologically active prostaglandins. It is also named as COX1(Cyclooxygenase-1). There is no PTGS1 expression in fetal samples (prostate, seminal vesicles, or ejaculatory ducts), and only minimal expression in adult tissues (PMID: 10999846). PTGS1 has some isoforms with MW of 56-72 kD and PTGS1 can form homodimer.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COX-1/Cyclooxygenase-1 antibody 13393-1-AP | Download protocol |
| IP protocol for COX-1/Cyclooxygenase-1 antibody 13393-1-AP | Download protocol |
| WB protocol for COX-1/Cyclooxygenase-1 antibody 13393-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
COX-1/Cyclooxygenase-1 Polyclonal antibody (Cat# 13393-1-AP) has 44 citations spanning journals such as Cell Metabolism, Nature Communications, Redox Biology, Theranostics, Small, Free Radical Biology and Medicine, International Journal of Molecular Sciences, and eLife. Associated research fields include mitochondrial biology, arachidonic acid and prostaglandin metabolism, inflammation, cancer, renal and liver disease, cardiovascular biology, neuroinflammation, ferroptosis, and cuproptosis.
| Species | Application | Title |
|---|---|---|
Cell Metab m6A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1 | ||
Nat Commun FUS unveiled in mitochondrial DNA repair and targeted ligase-1 expression rescues repair-defects in FUS-linked motor neuron disease | ||
Redox Biol Iron overload exaggerates renal ischemia-reperfusion injury by promoting tubular cuproptosis via interrupting function of LIAS | ||
Acta Pharm Sin B Organic carbon monoxide prodrug, BW-CO-111, in protection against chemically-induced gastric mucosal damage. | ||
J Control Release A COX-2 PROTAC Nanodrug for osteoarthritis therapy via enhancing cartilage repair and reprogramming macrophage polarization. |
Reviews
What customers say
All three reviews rate the antibody 5 stars. Users report excellent performance across Western blot, immunohistochemistry, and immunofluorescence. In WB, a clear band at the expected molecular weight was observed with minimal background at 1:1000 dilution, and results were consistent across experiments. One user noted precise band sizes at 1:600 dilution for WB, IHC, and IF. For IF on HeLa cells, a 1:200 dilution with 1-hour incubation yielded strong, clean staining. Overall, reviewers highlight high specificity, low background, and reliable reproducibility.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Meixin (Verified Customer) (03-10-2026) | This antibody performs well in Western blot. A clear band was detected at the expected size with minimal background. Used at 1:1000 dilution and the results were consistent across experiments.
|
Mounika (Verified Customer) (01-08-2026) | Amazing antibodies, works very well, bands size are precise!
|
Thomas (Verified Customer) (09-18-2020) | HeLa cells were fixed in 4% PFA for 15 mins and permeabilised in 0.1% Triton-X 100 in PBS. Cells were blocked in 1% BSA. Primary antibody solution was diluted at 1:200 in blocking solution and incubated for 1 hour. Goat anti-rabbit 488 Alexa Fluor secondary antibody (1:250 - green) and DAPI (1:2000 - blue) were incubated with cells for 1 hour.
 |
