Product Information
19913-1-AP targets PTH in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13790 Product name: Recombinant human PTH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-115 aa of BC096142 Sequence: GKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ Predict reactive species |
| Full Name | parathyroid hormone |
| Calculated Molecular Weight | 115 aa, 13 kDa |
| GenBank Accession Number | BC096142 |
| Gene Symbol | PTH |
| Gene ID (NCBI) | 5741 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01270 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
