Recombinant human PTPN22 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag2397
Synonyms
PTPN22, EC:3.1.3.48, Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP, LyP, LYP1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF
(1-179 aa encoded by BC017785) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
