PTPRA Polyclonal antibody, PBS Only

• 

  WB analysis using 13079-1-AP (same clone as 13079-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13079-1-AP (PTPRA antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13079-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 13079-1-AP (same clone as 13079-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 13079-1-AP (PTPRA antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13079-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A431 using 13079-1-AP (same clone as 13079-1-PBS)

  IP result of anti-PTPRA (IP:13079-1-AP, 4ug; Detection:13079-1-AP 1:300) with A431 cells lysate 2400ug. This data was developed using the same antibody clone with 13079-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 13079-1-AP (same clone as 13079-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13079-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 13079-1-AP (same clone as 13079-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13079-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 13079-1-AP (same clone as 13079-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13079-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 13079-1-AP (same clone as 13079-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13079-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 13079-1-AP (same clone as 13079-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13079-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 13079-1-AP (same clone as 13079-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13079-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 13079-1-AP (same clone as 13079-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using PTPRA antibody (13079-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13079-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PTPRA Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 13079-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

13079-1-PBS targets PTPRA in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3760

  Product name: Recombinant human LRP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 494-793 aa of BC027308

  Sequence: LYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYIDAFSDYANFK

• Full Name: protein tyrosine phosphatase, receptor type, A
• Calculated Molecular Weight: 793 aa, 91 kDa
• Observed Molecular Weight: 90-105 kDa, 140 kDa
• GenBank Accession Number: BC027308
• Gene Symbol: PTPRA
• Gene ID (NCBI): 5786
• RRID: AB_2269055
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18433
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.