PTPRA Polyclonal antibody

• 

  WB analysis of rat liver using 13079-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 13079-1-AP (PTPRA antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13079-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13079-1-AP (PTPRA antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A431 using 13079-1-AP

  IP result of anti-PTPRA (IP:13079-1-AP, 4ug; Detection:13079-1-AP 1:300) with A431 cells lysate 2400ug.

• 

  IHC staining of human lung cancer using 13079-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 13079-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 13079-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 13079-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat heart using 13079-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 13079-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 13079-1-AP (PTPRA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 13079-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using PTPRA antibody (13079-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

PTPRA Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13079-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

LRP, HPTPalpha, HPTPA, HLPR, HEPTP

---

Tested Applications

• Positive WB detected in: A431 cells, rat liver tissue, MCF-7 cells, SKOV-3 cells
• Positive IP detected in: A431 cells
• Positive IHC detected in: human lung cancer tissue, human urothelial carcinoma tissue, mouse heart tissue, mouse kidney tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

13079-1-AP targets PTPRA in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3760

  Product name: Recombinant human LRP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 494-793 aa of BC027308

  Sequence: LYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYIDAFSDYANFK

• Full Name: protein tyrosine phosphatase, receptor type, A
• Calculated Molecular Weight: 793 aa, 91 kDa
• Observed Molecular Weight: 90-105 kDa, 140 kDa
• GenBank Accession Number: BC027308
• Gene Symbol: PTPRA
• Gene ID (NCBI): 5786
• RRID: AB_2269055
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18433
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncol Lett; PTPRA facilitates cancer growth and migration via the TNF-α-mediated PTPRA-NF-κB pathway in MCF-7 breast cancer cells.; Authors - Canfeng Lin ; KO Validated
human	WB,IF,IP	Oncogene; Glucose-mediated N-glycosylation of RPTPα affects its subcellular localization and Src activation; Authors - Jiayu Fang
mouse	WB	Sci Signal; Clustering of phosphatase RPTPα promotes Src signaling and the arthritogenic action of synovial fibroblasts; Authors - Sho Sendo
human	WB	EBioMedicine; The circRNA circPTPRA suppresses epithelial-mesenchymal transitioning and metastasis of NSCLC cells by sponging miR-96-5p.; Authors - Siliang Wei ; KD Validated