PTPRH Monoclonal antibody, PBS Only

• 

  WB analysis of pig spleen using 68635-1-Ig (same clone as 68635-1-PBS)

  pig spleen tissue were subjected to SDS PAGE followed by western blot with 68635-1-Ig (PTPRH antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68635-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 68635-1-Ig (same clone as 68635-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 68635-1-Ig (PTPRH antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68635-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HT-29 using 68635-1-Ig (same clone as 68635-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HT-29 cells using PTPRH antibody (68635-1-Ig, Clone: 3C6E8 ) at dilution of 1:500 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 68635-1-PBS in a different storage buffer formulation.

PTPRH Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68635-1-PBS

Clone No.3C6E8

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

3C6E8, R PTP H, SAP 1, SAP1

---

Product Information

68635-1-PBS targets PTPRH in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17351

  Product name: Recombinant human PTPRH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 378-727 aa of BC111716

  Sequence: ETRNATTAPNPVRNLHMETQTNSSIALCWEVPDGPYPQDYTYWVEYTGDGGGTETRNTTNTSVTAERLEPGTLYTFSVWAEKNGARGSRQNVSISTVPNAVTSLSKQDWTNSTIALRWTAPQGPGQSSYSYWVSWVREGMTDPRTQSTSGTDITLKELEAGSLYHLTVWAERNEVRGYNSTLTAATAPNEVTDLQNETQTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLCASTYPDTVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEVGGQRGSQDRSSCGEAVSVLGLGPARSY

• Full Name: protein tyrosine phosphatase, receptor type, H
• Calculated Molecular Weight: 1115 aa, 122 kDa
• Observed Molecular Weight: 200-210 kDa
• GenBank Accession Number: BC111716
• Gene Symbol: PTPRH
• Gene ID (NCBI): 5794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9HD43
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PTPRH, also known as SAP-1 (Stomach Cancer-Associated Protein-Tyrosine Phosphatase-1), is a member of the protein tyrosine phosphatase (PTP) family. These enzymes regulate cellular signaling by dephosphorylating tyrosine residues on proteins, counterbalancing kinase activity (PMID: 11278335). PTPRH is classified as a receptor-type PTP, characterized by an extracellular domain, a transmembrane region, and intracellular catalytic domains. In colorectal, gastric, and hepatocellular cancers, PTPRH is often upregulated and linked to poor prognosis (PMID: 12101188). Paradoxically, it may suppress tumorigenesis in other contexts by stabilizing cell adhesion. Overexpression in certain cancers suggests utility as a diagnostic or prognostic marker. The molecular weight of PTPRH is 122 kDa, it is reported that it can form a dimer with a molecular weight of 210 kDa (PMID:15850787).