PTPRH Monoclonal antibody, PBS Only

PTPRH Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68635-1-PBS
Clone No.3C6E8

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IF/ICC, Indirect ELISA

3C6E8, R PTP H, SAP 1, SAP1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68635-1-PBS targets PTPRH in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17351

Product name: Recombinant human PTPRH protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 378-727 aa of BC111716

Sequence: ETRNATTAPNPVRNLHMETQTNSSIALCWEVPDGPYPQDYTYWVEYTGDGGGTETRNTTNTSVTAERLEPGTLYTFSVWAEKNGARGSRQNVSISTVPNAVTSLSKQDWTNSTIALRWTAPQGPGQSSYSYWVSWVREGMTDPRTQSTSGTDITLKELEAGSLYHLTVWAERNEVRGYNSTLTAATAPNEVTDLQNETQTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLCASTYPDTVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEVGGQRGSQDRSSCGEAVSVLGLGPARSY

Predict reactive species
Full Name protein tyrosine phosphatase, receptor type, H
Calculated Molecular Weight 1115 aa, 122 kDa
Observed Molecular Weight200-210 kDa
GenBank Accession NumberBC111716
Gene Symbol PTPRH
Gene ID (NCBI) 5794
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9HD43
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PTPRH, also known as SAP-1 (Stomach Cancer-Associated Protein-Tyrosine Phosphatase-1), is a member of the protein tyrosine phosphatase (PTP) family. These enzymes regulate cellular signaling by dephosphorylating tyrosine residues on proteins, counterbalancing kinase activity (PMID: 11278335). PTPRH is classified as a receptor-type PTP, characterized by an extracellular domain, a transmembrane region, and intracellular catalytic domains. In colorectal, gastric, and hepatocellular cancers, PTPRH is often upregulated and linked to poor prognosis (PMID: 12101188). Paradoxically, it may suppress tumorigenesis in other contexts by stabilizing cell adhesion. Overexpression in certain cancers suggests utility as a diagnostic or prognostic marker. The molecular weight of PTPRH is 122 kDa, it is reported that it can form a dimer with a molecular weight of 210 kDa (PMID:15850787).

Loading...
||
New chat

Able

正在加载,请稍候...