PTPRK Polyclonal antibody

• 

  WB analysis using 28151-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28151-1-AP (PTPRK antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28151-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 28151-1-AP (PTPRK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PTPRK Polyclonal Antibody for WB, ELISA

Cat No. 28151-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

DKFZp686C2268, DKFZp779N1045, PTPK, PTPRK, R PTP kappa

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, rat spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28151-1-AP targets PTPRK in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27765

  Product name: Recombinant human PTPRK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 635-750 aa of BC140775

  Sequence: EELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKETKTQCVRIATKAAATEEPEVIPDPAKQTDR

• Full Name: protein tyrosine phosphatase, receptor type, K
• Calculated Molecular Weight: 1439 aa, 162 kDa
• Observed Molecular Weight: 100-120 kDa
• GenBank Accession Number: BC140775
• Gene Symbol: PTPRK
• Gene ID (NCBI): 5796
• RRID: AB_2881074
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15262
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPRK (Protein Tyrosine Phosphatase Receptor Type Kappa), a member of the receptor-type protein tyrosine phosphatase family, is a transmembrane protein that regulates cell-cell contact. PTPRK is a 210 kDa precursor protein and converted by furin to a mature heterodimeric protein composed of a non-covalently attached amino-terminal extracellular subunit (E-subunit, 120 kDa) and carboxyl-terminal transmembrane subunit (P-subunit, 95 kDa) (PMID: 24882578, 16648485). Loss of PTPRK activity has been observed in pancreatic cancer, primary CNS lymphoma and melanoma, and is associated with poor survival of cancer patients, which suggest that PTPRK is a potential tumor suppressor (PMID: 23696788).