Tested Applications
Positive WB detected in | mouse spleen tissue, rat spleen tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
28151-1-AP targets PTPRK in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Reactivity | Human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27765 Product name: Recombinant human PTPRK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 635-750 aa of BC140775 Sequence: EELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKETKTQCVRIATKAAATEEPEVIPDPAKQTDR Predict reactive species |
Full Name | protein tyrosine phosphatase, receptor type, K |
Calculated Molecular Weight | 1439 aa, 162 kDa |
Observed Molecular Weight | 100-120 kDa |
GenBank Accession Number | BC140775 |
Gene Symbol | PTPRK |
Gene ID (NCBI) | 5796 |
RRID | AB_2881074 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q15262 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PTPRK (Protein Tyrosine Phosphatase Receptor Type Kappa), a member of the receptor-type protein tyrosine phosphatase family, is a transmembrane protein that regulates cell-cell contact. PTPRK is a 210 kDa precursor protein and converted by furin to a mature heterodimeric protein composed of a non-covalently attached amino-terminal extracellular subunit (E-subunit, 120 kDa) and carboxyl-terminal transmembrane subunit (P-subunit, 95 kDa) (PMID: 24882578, 16648485). Loss of PTPRK activity has been observed in pancreatic cancer, primary CNS lymphoma and melanoma, and is associated with poor survival of cancer patients, which suggest that PTPRK is a potential tumor suppressor (PMID: 23696788).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PTPRK antibody 28151-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |