Product Information
28151-1-PBS targets PTPRK in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27765 Product name: Recombinant human PTPRK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 635-750 aa of BC140775 Sequence: EELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKETKTQCVRIATKAAATEEPEVIPDPAKQTDR Predict reactive species |
| Full Name | protein tyrosine phosphatase, receptor type, K |
| Calculated Molecular Weight | 1439 aa, 162 kDa |
| Observed Molecular Weight | 100-120 kDa |
| GenBank Accession Number | BC140775 |
| Gene Symbol | PTPRK |
| Gene ID (NCBI) | 5796 |
| RRID | AB_2881074 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15262 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PTPRK (Protein Tyrosine Phosphatase Receptor Type Kappa), a member of the receptor-type protein tyrosine phosphatase family, is a transmembrane protein that regulates cell-cell contact. PTPRK is a 210 kDa precursor protein and converted by furin to a mature heterodimeric protein composed of a non-covalently attached amino-terminal extracellular subunit (E-subunit, 120 kDa) and carboxyl-terminal transmembrane subunit (P-subunit, 95 kDa) (PMID: 24882578, 16648485). Loss of PTPRK activity has been observed in pancreatic cancer, primary CNS lymphoma and melanoma, and is associated with poor survival of cancer patients, which suggest that PTPRK is a potential tumor suppressor (PMID: 23696788).



