PTPRS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PTPRS Polyclonal antibody (13008-1-AP)

• Featured Product
• KD/KO Validated

PTPRS Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13008-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EC:3.1.3.48, PTPSIGMA, R PTP S, R PTP sigma, Receptor-type tyrosine-protein phosphatase S

• 

  WB analysis of HeLa using 13008-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13008-1-AP (PTPRS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13008-1-AP

  WB result of PTPRS antibody (13008-1-AP; 1:500; incubated at room temperature for 1.5 hours) with sh-Control and sh-PTPRS transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 13008-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13008-1-AP (PTPRS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 13008-1-AP

  IP result of anti-PTPRS (IP:13008-1-AP, 5ug; Detection:13008-1-AP 1:400) with mouse brain tissue lysate 6500ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 13008-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13008-1-AP (PTPRS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 13008-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13008-1-AP (PTPRS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PTPRS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13008-1-AP targets PTPRS in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3691

  Product name: Recombinant human rPTPσ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-128 aa of BC029496

  Sequence: GGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLRGP

• Full Name: protein tyrosine phosphatase, receptor type, S
• Calculated Molecular Weight: 128aa,14 kDa; 1948aa,217 kDa
• Observed Molecular Weight: 75-100 kDa
• GenBank Accession Number: BC029496
• Gene Symbol: PTPRS
• Gene ID (NCBI): 5802
• RRID: AB_10858319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13332
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type II a receptor protein tyrosine phosphatases (rPTPσ) are cell surface receptors important for nervous system development, function, and repair.The expression of rPTPσ has previously been reported in b-cells and other target organs for INS although the probes chosen did not permit to distinguish between the splice variants.Proteolytic processing near the transmembrane domain generates an extracellular N-terminal E-domain of 130 kDa and a C-terminal P-domain of approximately 85 kDa of rPTPσ,and the short splice variants rPTPσ 3 and 4 contain an E-domain of 95 kDa (PMID: 16552719). rPTPσ expression was observed in tissue lysates of the adult mouse sensory-motor cortex and thoracic spinal cord (T8-T10) as a 75-80kDa immunoreactive band (PMID: 19780196).

Publications

What published studies show

The PTPRS Polyclonal antibody (Cat# 13008-1-AP) has 12 citations spanning journals including Nature, Science, Cancer Letters, Cell Reports, Aging Cell, Inflammation, ACS Chemical Neuroscience, Molecular Carcinogenesis, Journal of Gene Medicine, Journal of Cellular Biochemistry, Current Eye Research, and eLife. Research fields cover neuroimmune interactions, EMT in neurofibromas, presynaptic assembly, immunosuppression, psoriasis, nerve regeneration, glioblastoma metastasis, oral squamous cell carcinoma, neural stem cell migration, visual cortex development, and synaptic plasticity.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nature; Psychedelic control of neuroimmune interactions governing fear; Authors - Elizabeth N Chung
human		Science; SPARK-seq: A high-throughput platform for aptamer discovery and kinetic profiling.; Authors - Guoyan Luo
human	WB,IHC	Cancer Lett; Reduced PTPRS expression promotes epithelial-mesenchymal transition of Schwann cells in NF1-related plexiform neurofibromas; Authors - Yuehua Li
mouse	WB	Aging Cell; Chronic TNF exposure induces glucocorticoid-like immunosuppression in the alveolar macrophages of aged mice that enhances their susceptibility to pneumonia; Authors - Katherine L Kruckow
		Cell Rep; Pleiotrophin regulates presynaptic assembly and function through heparan sulfate-dependent binding to neurexin1.; Authors - Qin Xu
human	IHC	Inflammation; Mass Spectrometry-Based Proteomics Analysis Unveils PTPRS Inhibits Proliferation and Inflammatory Response of Keratinocytes in Psoriasis; Authors - Xuyu Zheng