PTPRS Polyclonal antibody

• 

  WB analysis of HeLa using 13008-1-AP

  WB result of PTPRS antibody (13008-1-AP; 1:500; incubated at room temperature for 1.5 hours) with sh-Control and sh-PTPRS transfected HeLa cells.

• 

  WB analysis of HeLa using 13008-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13008-1-AP (PTPRS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 13008-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13008-1-AP (PTPRS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 13008-1-AP

  IP result of anti-PTPRS (IP:13008-1-AP, 5ug; Detection:13008-1-AP 1:400) with mouse brain tissue lysate 6500ug.

• 

  IHC staining of human kidney using 13008-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13008-1-AP (PTPRS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 13008-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13008-1-AP (PTPRS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PTPRS Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 13008-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

PTPRS, PTPSIGMA, R PTP S, R PTP sigma, rPTPσ

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 8 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

13008-1-AP targets PTPRS in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3691

  Product name: Recombinant human rPTPσ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-128 aa of BC029496

  Sequence: GGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLRGP

• Full Name: protein tyrosine phosphatase, receptor type, S
• Calculated Molecular Weight: 128aa,14 kDa; 1948aa,217 kDa
• Observed Molecular Weight: 75-100 kDa
• GenBank Accession Number: BC029496
• Gene Symbol: PTPRS
• Gene ID (NCBI): 5802
• RRID: AB_10858319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13332
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type II a receptor protein tyrosine phosphatases (rPTPσ) are cell surface receptors important for nervous system development, function, and repair.The expression of rPTPσ has previously been reported in b-cells and other target organs for INS although the probes chosen did not permit to distinguish between the splice variants.Proteolytic processing near the transmembrane domain generates an extracellular N-terminal E-domain of 130 kDa and a C-terminal P-domain of approximately 85 kDa of rPTPσ,and the short splice variants rPTPσ 3 and 4 contain an E-domain of 95 kDa (PMID: 16552719). rPTPσ expression was observed in tissue lysates of the adult mouse sensory-motor cortex and thoracic spinal cord (T8-T10) as a 75-80kDa immunoreactive band (PMID: 19780196).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Elife; Synaptic plasticity and cognitive function are disrupted in the absence of Lrp4.; Authors - Andrea M Gomez
human	WB	ACS Chem Neurosci; Small Molecules Targeting PTPσ-Trk Interactions Promote Sympathetic Nerve Regeneration.; Authors - Matthew R Blake
human	WB	J Gene Med; Downregulation of lncRNA HCG11 promotes cell proliferation of oral squamous cell carcinoma through sponging miR-455-5p.; Authors - Jingjing Wu
rat	WB,IHC	Curr Eye Res; Expression of Perineuronal Nets, Parvalbumin and Protein Tyrosine Phosphatase σ in the Rat Visual Cortex During Development and After BFD.; Authors - Liu Hui H
mouse	IF,WB	J Cell Biochem; Chondroitin sulfate proteoglycan represses neural stem/progenitor cells migration via PTPσ/α-actinin4 signaling pathway.; Authors - Jun Zhong
mouse	WB	Aging Cell; Chronic TNF exposure induces glucocorticoid-like immunosuppression in the alveolar macrophages of aged mice that enhances their susceptibility to pneumonia; Authors - Katherine L Kruckow