PTTG1IP Polyclonal antibody, PBS Only

• 

  WB analysis using 12575-1-AP (same clone as 12575-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12575-1-AP (PTTG1IP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12575-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 12575-1-AP (same clone as 12575-1-PBS)

  IP result of anti-PTTG1IP (IP:12575-1-AP, 4ug; Detection:12575-1-AP 1:300) with HEK-293 cells lysate 2600 ug. This data was developed using the same antibody clone with 12575-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 12575-1-AP (same clone as 12575-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 12575-1-AP (PTTG1IP antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12575-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 12575-1-AP (same clone as 12575-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 12575-1-AP (PTTG1IP antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12575-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 12575-1-AP (same clone as 12575-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 12575-1-AP (PTTG1IP antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12575-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 12575-1-AP (same clone as 12575-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 12575-1-AP (PTTG1IP antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12575-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 12575-1-AP (same clone as 12575-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 12575-1-AP (PTTG1IP antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12575-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 12575-1-AP (same clone as 12575-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 12575-1-AP (PTTG1IP antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12575-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12575-1-AP (same clone as 12575-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PTTG1IP antibody (12575-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 12575-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 12575-1-AP (same clone as 12575-1-PBS)

  Immunofluorescent analysis of PC-3 cells using 12575-1-AP (PTTG1IP antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12575-1-PBS in a different storage buffer formulation.

PTTG1IP Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12575-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

12575-1-PBS targets PTTG1IP in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3250

  Product name: Recombinant human PTTG1IP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC012858

  Sequence: MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN

• Full Name: pituitary tumor-transforming 1 interacting protein
• Calculated Molecular Weight: 180 aa, 20 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC012858
• Gene Symbol: PTTG1IP
• Gene ID (NCBI): 754
• RRID: AB_10644145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53801
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.