Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11213-1-AP targets Nectin 3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1712 Product name: Recombinant human PVRL3, Nectin 3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 449-549 aa of BC017572 Sequence: MQKESQIDVLQQDELDSYPDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGSVISRREWYV Predict reactive species |
| Full Name | poliovirus receptor-related 3 |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | BC017572 |
| Gene Symbol | Nectin-3 |
| Gene ID (NCBI) | 25945 |
| RRID | AB_2269095 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQS3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nectin 3, also known as CD113, is a member of the nectin family of cell adhesion molecules. It plays a crucial role in cell-cell adhesion and the formation of adherens junctions, which are essential for maintaining tissue integrity and cell polarity. Nectin 3 can form homophilic and heterophilic interactions, meaning it can bind to itself or other nectin family members, such as Nectin-2 (PMID: 10744716; 22902367). These interactions are important for processes like cell migration, tissue development, and immune cell transmigration (PMID: 12901789; 24116228).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Nectin 3 antibody 11213-1-AP | Download protocol |
| IP protocol for Nectin 3 antibody 11213-1-AP | Download protocol |
| WB protocol for Nectin 3 antibody 11213-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Nectin 3 Polyclonal antibody (catalog no. 11213-1-AP) has 7 citations. These appear in journals including Cancer Communications, Nature Chemical Biology, Gut Microbes, Frontiers in Microbiology, Journal of Neurochemistry, Biomedicine & Pharmacotherapy, and Biology of Reproduction. Research fields span nasopharyngeal carcinoma metastasis, live-brain receptor labeling, Clostridioides difficile toxin B inflammation, nectin γ-secretase processing, ovarian cancer biomarkers, and mouse spermiogenesis endocytosis. Applications cited include WB, IF, and IHC.
| Species | Application | Title |
|---|---|---|
Cancer Commun (Lond) ZNF582 hypermethylation promotes metastasis of nasopharyngeal carcinoma by regulating the transcription of adhesion molecules Nectin-3 and NRXN3. | ||
Nat Chem Biol Photoproximity labeling of endogenous receptors in the live mouse brain in minutes | ||
Gut Microbes CD44 is a macrophage receptor for TcdB from Clostridioides difficile that via its lysine-158 succinylation contributes to inflammation | ||
Front Microbiol Expression and (Lacking) Internalization of the Cell Surface Receptors of Clostridioides difficile Toxin B. | ||
J Neurochem Characterization of nectin processing mediated by presenilin-dependent γ-secretase. | ||
Biomed Pharmacother Nectin-3 is a new biomarker that mediates the upregulation of MMP2 and MMP9 in ovarian cancer cells. |
Reviews
What customers say
The single review for this PVRL3 antibody reports a 5-star rating from a Western Blot application. The reviewer used it successfully on two ovarian cancer cell lines (OV8 and OV90), noting the antibody "worked wonderfully" and expressing satisfaction with the results. Overall, the feedback is positive, highlighting strong performance and reliable results in cell line-based WB experiments.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Morgan (Verified Customer) (08-09-2021) | This PVRL3 antibody worked wonderfully with 2 ovarian cancer cell lines; OV8 and OV90. I was very pleased with the results.
 |
