Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
Product Information
11213-1-AP targets Nectin 3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1712 Product name: Recombinant human PVRL3, Nectin 3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 449-549 aa of BC017572 Sequence: MQKESQIDVLQQDELDSYPDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGSVISRREWYV Predict reactive species |
| Full Name | poliovirus receptor-related 3 |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | BC017572 |
| Gene Symbol | Nectin-3 |
| Gene ID (NCBI) | 25945 |
| RRID | AB_2269095 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQS3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nectin 3, also known as CD113, is a member of the nectin family of cell adhesion molecules. It plays a crucial role in cell-cell adhesion and the formation of adherens junctions, which are essential for maintaining tissue integrity and cell polarity. Nectin 3 can form homophilic and heterophilic interactions, meaning it can bind to itself or other nectin family members, such as Nectin-2 (PMID: 10744716; 22902367). These interactions are important for processes like cell migration, tissue development, and immune cell transmigration (PMID: 12901789; 24116228).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Nectin 3 antibody 11213-1-AP | Download protocol |
| IP protocol for Nectin 3 antibody 11213-1-AP | Download protocol |
| WB protocol for Nectin 3 antibody 11213-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Commun (Lond) ZNF582 hypermethylation promotes metastasis of nasopharyngeal carcinoma by regulating the transcription of adhesion molecules Nectin-3 and NRXN3. | ||
Front Microbiol Expression and (Lacking) Internalization of the Cell Surface Receptors of Clostridioides difficile Toxin B. | ||
J Neurochem Characterization of nectin processing mediated by presenilin-dependent γ-secretase. | ||
Biomed Pharmacother Nectin-3 is a new biomarker that mediates the upregulation of MMP2 and MMP9 in ovarian cancer cells. | ||
Biol Reprod Myosin VI maintains the actin-dependent organization of the tubulobulbar complexes required for endocytosis during mouse spermiogenesis. | ||
Nat Chem Biol Photoproximity labeling of endogenous receptors in the live mouse brain in minutes |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Morgan (Verified Customer) (08-09-2021) | This PVRL3 antibody worked wonderfully with 2 ovarian cancer cell lines; OV8 and OV90. I was very pleased with the results.
![]() |






