PXMP3 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 22163-1-AP (same clone as 22163-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 22163-1-AP (PXMP3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22163-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 22163-1-AP (same clone as 22163-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 22163-1-AP (PXMP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22163-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 22163-1-AP (same clone as 22163-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 22163-1-AP (PXMP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22163-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 22163-1-AP (same clone as 22163-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22163-1-AP (PXMP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22163-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 22163-1-AP (same clone as 22163-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22163-1-AP (PXMP3 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22163-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 22163-1-AP (same clone as 22163-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22163-1-AP (PXMP3 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22163-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 22163-1-AP (same clone as 22163-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22163-1-AP (PXMP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22163-1-PBS in a different storage buffer formulation.

PXMP3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22163-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

PEX2, 35 kDa peroxisomal membrane protein, EC:2.3.2.27, PAF1, PAF-1

---

Product Information

22163-1-PBS targets PXMP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17815

  Product name: Recombinant human PXMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 213-305 aa of BC000661

  Sequence: VQKLKAKLSSWCIPLTGAPNSDNTLATSGKECALCGERPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNPL

• Full Name: peroxisomal membrane protein 3, 35kDa
• Calculated Molecular Weight: 305 aa, 35 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC000661
• Gene Symbol: PXMP3
• Gene ID (NCBI): 5828
• RRID: AB_2879014
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P28328
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.