Product Information
22163-1-PBS targets PXMP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17815 Product name: Recombinant human PXMP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 213-305 aa of BC000661 Sequence: VQKLKAKLSSWCIPLTGAPNSDNTLATSGKECALCGERPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNPL Predict reactive species |
| Full Name | peroxisomal membrane protein 3, 35kDa |
| Calculated Molecular Weight | 305 aa, 35 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | BC000661 |
| Gene Symbol | PXMP3 |
| Gene ID (NCBI) | 5828 |
| RRID | AB_2879014 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P28328 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |













