peptide YY Polyclonal antibody

• 

  IHC staining of human pancreas using 24294-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 24294-1-AP (peptide YY antibody at dilution of 1:50.

• 

  IHC staining of human pancreas using 24294-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 24294-1-AP (peptide YY antibody at dilution of 1:50.

• 

  IHC staining of human small intestine using 24294-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine slide using 24294-1-AP (peptide YY antibody at dilution of 1:50.

• 

  IHC staining of human small intestine using 24294-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine slide using 24294-1-AP (peptide YY antibody at dilution of 1:50.

• 

  IHC staining of human colon using 24294-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon slide using 24294-1-AP (peptide YY antibody at dilution of 1:50.

• 

  IHC staining of human colon using 24294-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon slide using 24294-1-AP (peptide YY antibody at dilution of 1:50.

peptide YY Polyclonal Antibody for IHC, ELISA

Cat No. 24294-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

Peptide tyrosine tyrosine, peptide YY, PYY, PYY I, PYY II, PYY1

---

Tested Applications

• Positive IHC detected in: human pancreas tissue, human colon tissue, human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

24294-1-AP targets peptide YY in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17939

  Product name: Recombinant human PYY protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-97 aa of BC041057

  Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW

• Full Name: peptide YY
• Calculated Molecular Weight: 97 aa, 11 kDa
• GenBank Accession Number: BC041057
• Gene Symbol: Peptide YY
• Gene ID (NCBI): 5697
• RRID: AB_2879477
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10082
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Anal Chem; Development of a Primary Human Intestinal Epithelium Enriched in L-Cells for Assay of GLP-1 Secretion.; Authors - Cecilia Villegas-Novoa
mouse	WB	Front Cell Infect Microbiol; Appetite Suppression and Interleukin 17 Receptor Signaling Activation of Colonic Mycobiota Dysbiosis Induced by High Temperature and High Humidity Conditions.; Authors - Yinrui Guo
human	WB,IHC,IF	Am J Cancer Res; PYY modulates the tumorigenesis and progression of colorectal cancer unveiled by proteomics; Authors - Fangyan Jing