Tested Applications
Positive IHC detected in | human pancreas tissue, human colon tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
Product Information
24294-1-AP targets peptide YY in WB, IF, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17939 Product name: Recombinant human PYY protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 29-97 aa of BC041057 Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW Predict reactive species |
Full Name | peptide YY |
Calculated Molecular Weight | 97 aa, 11 kDa |
GenBank Accession Number | BC041057 |
Gene Symbol | Peptide YY |
Gene ID (NCBI) | 5697 |
RRID | AB_2879477 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P10082 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for peptide YY antibody 24294-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Anal Chem Development of a Primary Human Intestinal Epithelium Enriched in L-Cells for Assay of GLP-1 Secretion. | ||
Front Cell Infect Microbiol Appetite Suppression and Interleukin 17 Receptor Signaling Activation of Colonic Mycobiota Dysbiosis Induced by High Temperature and High Humidity Conditions. | ||
Am J Cancer Res PYY modulates the tumorigenesis and progression of colorectal cancer unveiled by proteomics |