Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PARK2/Parkin Monoclonal antibody

PARK2/Parkin Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66674-1-Ig
Clone No.2H5A7

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA

PARK2, Parkin, 2H5A7, E3 ubiquitin-protein ligase parkin, EC:2.3.2.31

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, SH-SY5Y cells, U-251 cells, mouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inRAW 264.7 cells, SH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:8000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66674-1-Ig targets PARK2/Parkin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, sheep
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5179

Product name: Recombinant human Parkin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 81-387 aa of BC022014

Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK

Predict reactive species
Full Name Parkinson disease (autosomal recessive, juvenile) 2, parkin
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 42-52 kDa
GenBank Accession NumberBC022014
Gene Symbol Parkin
Gene ID (NCBI) 5071
RRIDAB_2882028
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60260
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a viariety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. It has 8 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for PARK2/Parkin antibody 66674-1-IgDownload protocol
IHC protocol for PARK2/Parkin antibody 66674-1-IgDownload protocol
WB protocol for PARK2/Parkin antibody 66674-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouse,humanWB

Nature

Cytosolic acetyl-coenzyme A is a signalling metabolite to control mitophagy.

Authors - Yifan Zhang
humanWB,IF

Bone Res

Enhanced SIRT3 expression restores mitochondrial quality control mechanism to reverse osteogenic impairment in type 2 diabetes mellitus

Authors - Yansi Xian

Autophagy

KDM4A-induced tumor senescence enhances the efficacy of immunotherapy by inhibiting AGT-PHB1 axis-mediated mitophagy in colorectal cancer

Authors - Tanxing Cai
mouse,humanWB,IF

Autophagy

CircEPS15, as a sponge of MIR24-3p ameliorates neuronal damage in Parkinson disease through boosting PINK1-PRKN-mediated mitophagy

Authors - Yuanzhang Zhou
WB

Nat Commun

An AI-assisted fluorescence microscopic system for screening mitophagy inducers by simultaneous analysis of mitophagic intermediates

Authors - Yicheng Wang

Nat Commun

Remodeling adipocytes' lipid metabolism with a polycation loaded enzyme-active framework reverses osteoporotic bone marrow

Authors - Wenzheng Lin

Reviews

    3.0 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Rhiannon (Verified Customer) (09-16-2026)

No bands with PBS-T + 5% milk as advised on data sheet. Antibody trialled in TBS-T + 5% milk with bands throughout the gel. Unclear which band is specific to Parkin which could lead to false interpretation.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK-293T
PARK2/Parkin Antibody Western Blot validation (1:1000 dilution) in HEK-293T (Cat no:66674-1-Ig)

Paula (Verified Customer) (07-26-2024)

Worked well for Western Blotting when made fresh. However, after freezing antibody stock (in 3% BSA) did not work.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human Bone Marrow Mesenchymal Stem Cells
PARK2/Parkin Antibody Western Blot validation (1:1000 dilution) in Human Bone Marrow Mesenchymal Stem Cells (Cat no:66674-1-Ig)

Tanusree (Verified Customer) (12-03-2019)

This antibody works good in western blotting analysis using mouse tissues.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain
Loading...
||
New chat

Able™

正在加载,请稍候...