PARK2/Parkin Monoclonal antibody

• 

  WB analysis of HEK-293 using 66674-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66674-1-Ig (Parkin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 66674-1-Ig

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 66674-1-Ig (Parkin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-251 using 66674-1-Ig

  U-251 cells were subjected to SDS PAGE followed by western blot with 66674-1-Ig (Parkin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 66674-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66674-1-Ig (Parkin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 66674-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66674-1-Ig (Parkin antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 66674-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66674-1-Ig (Parkin antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of RAW 264.7 using 66674-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed RAW 264.7 cells using PARK2/Parkin antibody (66674-1-Ig, Clone: 2H5A7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

PARK2/Parkin Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66674-1-Ig

Clone No.2H5A7

Publications(63)

Reviews (2)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Parkin, PARK2, Parkin RBR E3 ubiquitin-protein ligase, EC:2.3.2.31, E3 ubiquitin-protein ligase parkin

---

Tested Applications

• Positive WB detected in: HEK-293 cells, SH-SY5Y cells, U-251 cells, mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:8000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 53 publications below
• IHC: See 6 publications below
• IF: See 30 publications below

Product Information

66674-1-Ig targets PARK2/Parkin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5179

  Product name: Recombinant human Parkin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 81-387 aa of BC022014

  Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK

• Full Name: Parkinson disease (autosomal recessive, juvenile) 2, parkin
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 42-52 kDa
• GenBank Accession Number: BC022014
• Gene Symbol: Parkin
• Gene ID (NCBI): 5071
• RRID: AB_2882028
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60260
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a viariety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. It has 8 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Pineal Res; Melatonin and verteporfin synergistically suppress the growth and stemness of head and neck squamous cell carcinoma through the regulation of mitochondrial dynamics; Authors - Ye Young Shin
human,mouse	WB,IF	Autophagy; CircEPS15, as a sponge of MIR24-3p ameliorates neuronal damage in Parkinson disease through boosting PINK1-PRKN-mediated mitophagy; Authors - Yuanzhang Zhou
mouse	WB	Nat Commun; Hepatic expression of GAA results in enhanced enzyme bioavailability in mice and non-human primates.; Authors - Helena Costa-Verdera
human	IF	Oxid Med Cell Longev; Ginseng-Sanqi-Chuanxiong (GSC) Extracts Ameliorate Diabetes-Induced Endothelial Cell Senescence through Regulating Mitophagy via the AMPK Pathway.; Authors - Xue Wang
rat	WB	Oxid Med Cell Longev; Xuesaitong Combined with Dexmedetomidine Improves Cerebral Ischemia-Reperfusion Injury in Rats by Activating Keap1/Nrf2 Signaling and Mitophagy in Hippocampal Tissue; Authors - Guo-Jie Han
mouse	IF,WB	Cell Death Discov; Stomatin-like protein 2 deficiency exacerbates adverse cardiac remodeling; Authors - Yuntao Hu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Paula (Verified Customer) (07-26-2024)

Worked well for Western Blotting when made fresh. However, after freezing antibody stock (in 3% BSA) did not work.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human Bone Marrow Mesenchymal Stem Cells

PARK2/Parkin Antibody Western Blot validation (1:1000 dilution) in Human Bone Marrow Mesenchymal Stem Cells (Cat no:66674-1-Ig)

FH

Tanusree (Verified Customer) (12-03-2019)

This antibody works good in western blotting analysis using mouse tissues.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Mouse brain